Lus10014921 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24165 80 / 2e-21 unknown protein
AT4G23885 66 / 5e-16 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038814 162 / 3e-51 AT5G38250 165 / 2e-46 Protein kinase family protein (.1)
Lus10001827 79 / 4e-21 AT4G23885 86 / 6e-24 unknown protein
Lus10003881 76 / 7e-19 AT4G23885 75 / 1e-18 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G011600 83 / 2e-22 AT5G24165 89 / 4e-25 unknown protein
Potri.003G140300 77 / 2e-20 AT4G23885 85 / 2e-23 unknown protein
PFAM info
Representative CDS sequence
>Lus10014921 pacid=23152793 polypeptide=Lus10014921 locus=Lus10014921.g ID=Lus10014921.BGIv1.0 annot-version=v1.0
ATGGGAGGAGAAGGGCAGCTTCTGAAGAGAGTCCCGCGAATCAAGTTCCCCAAAAGACACTCATCCTCCTCAGGTTCACAGGGTCAGGAAACGGCAACAG
CCACAACAGGCAAAGGAAAGATGCAGTTCTCCATGGCATCTGGATCAGATGTCCCGCCATCGATCTCCGACACAACTGCTGGTGGGAAGGCTTCTCTTCA
GCCTAAACGTACGCCCGTCACAGATCAAGAGATTGAAGCTGTAATGCTGGGCGGATTGTTCTAA
AA sequence
>Lus10014921 pacid=23152793 polypeptide=Lus10014921 locus=Lus10014921.g ID=Lus10014921.BGIv1.0 annot-version=v1.0
MGGEGQLLKRVPRIKFPKRHSSSSGSQGQETATATTGKGKMQFSMASGSDVPPSISDTTAGGKASLQPKRTPVTDQEIEAVMLGGLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24165 unknown protein Lus10014921 0 1
AT5G53650 unknown protein Lus10032946 1.4 0.8488
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10032560 3.5 0.8092
AT2G31490 unknown protein Lus10027603 4.9 0.7891
AT5G40570 Surfeit locus protein 2 (SURF2... Lus10003658 6.3 0.7858
AT1G30475 unknown protein Lus10027131 7.3 0.7727
AT4G33740 unknown protein Lus10012453 7.7 0.7945
AT1G20580 Small nuclear ribonucleoprotei... Lus10030747 9.5 0.7701
AT2G02510 NADH dehydrogenase (ubiquinone... Lus10005182 10.5 0.7492
AT3G03100 NADH:ubiquinone oxidoreductase... Lus10007886 11.4 0.7408
AT5G63690 Nucleic acid-binding, OB-fold-... Lus10035799 14.1 0.7160

Lus10014921 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.