Lus10014942 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 302 / 2e-107 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT4G27960 301 / 7e-107 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G53300 300 / 2e-106 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT5G41700 300 / 2e-106 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08690 295 / 1e-104 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 281 / 3e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 276 / 4e-97 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 249 / 1e-86 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 166 / 4e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 152 / 7e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038827 309 / 4e-110 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 306 / 5e-109 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 306 / 5e-109 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 303 / 8e-108 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10033937 300 / 9e-107 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10022726 299 / 5e-106 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 299 / 5e-106 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 296 / 3e-105 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027846 285 / 9e-101 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G033000 306 / 7e-109 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 306 / 7e-109 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 305 / 1e-108 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.003G136200 303 / 9e-108 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 301 / 5e-107 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 300 / 1e-106 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 300 / 1e-106 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.011G168200 293 / 1e-103 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 293 / 1e-103 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 288 / 4e-102 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10014942 pacid=23152766 polypeptide=Lus10014942 locus=Lus10014942.g ID=Lus10014942.BGIv1.0 annot-version=v1.0
ATGGCGTCCAAGCGCATCTTGAAGGAGCTCAAGGATTTGCAGAAGGATCCTCCCACGTCTTGCAGCGCTGGTCCTGTTGCGGAGGACATGTTCCACTGGC
AAGCAACGATCATGGGTCCTCCAGATAGCCCTTATTCTGGTGGTGTTTTCCTGGTCACTATCCATTTCCCTCCGGATTATCCATTCAAGCCTCCCAAGGT
GGCTTTCAGAACAAAGGTGTTCCACCCGAATATCAACAGCAACGGTAGCATCTGTCTCGACATCTTGAAAGAACAGTGGAGCCCTGCTCTTACCATATCC
AAGGTGTTGCTCTCGATCTGCTCGTTGTTGACGGATCCCAACCCGGACGACCCATTGGTACCCGAGATTGCCCACATGTACAAAACAGACAGGCACAAGT
ACGAGACGACTGCAAGGAGCTGGACCCAGAAGTATGCCATGGGATGA
AA sequence
>Lus10014942 pacid=23152766 polypeptide=Lus10014942 locus=Lus10014942.g ID=Lus10014942.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRHKYETTARSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10014942 0 1
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10038827 3.0 0.9363
AT2G25280 unknown protein Lus10001925 3.5 0.8820
AT5G26751 ATSK11 ,SK 11 ARABIDOPSIS THALIANA SHAGGY-RE... Lus10031440 9.0 0.8768
AT4G25680 PPPDE putative thiol peptidase... Lus10014960 9.9 0.8554
AT1G15860 Domain of unknown function (DU... Lus10039198 10.8 0.8820
AT1G06400 ARA2, AtRABA1a,... ARABIDOPSIS THALIANA RAB GTPAS... Lus10020746 14.6 0.8198
AT3G49390 CID10 CTC-interacting domain 10 (.1.... Lus10008851 18.1 0.8910
AT5G15270 RNA-binding KH domain-containi... Lus10037163 18.8 0.8237
AT1G75440 UBC16 ubiquitin-conjugating enzyme 1... Lus10028341 19.1 0.8406
Lus10011059 19.9 0.8816

Lus10014942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.