Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36750 41 / 7e-05 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1) AT2G36780 39 / 0.0004 UDP-Glycosyltransferase superfamily protein (.1) AT2G36770 38 / 0.0006 UDP-Glycosyltransferase superfamily protein (.1) AT2G36790 38 / 0.0006 UGT73C6 UDP-glucosyl transferase 73C6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039302 [exp] 57 / 2e-10 AT3G16520 393 / 2e-133 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10039301 [exp] 49 / 2e-07 AT3G16520 481 / 9e-168 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10027542 [exp] 48 / 4e-07 AT3G16520 431 / 3e-148 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10039300 [exp] 44 / 2e-06 AT3G16520 100 / 2e-26 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10003386 [exp] 39 / 0.0004 AT5G01310 107 / 1e-24 APRATAXIN-like (.1) Lus10005951 [exp] 38 / 0.001 AT4G01070 510 / 5e-179 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G035800 [exp] 57 / 1e-10 AT3G16520 387 / 5e-131 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.012G036000 [exp] 57 / 2e-10 AT3G16520 385 / 1e-130 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.015G027700 [exp] 57 / 3e-10 AT3G16520 339 / 3e-112 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.015G027800 [exp] 57 / 3e-10 AT3G16520 355 / 1e-118 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.017G150000 [exp] 56 / 5e-10 AT3G16520 503 / 1e-176 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G069600 [exp] 54 / 3e-09 AT3G16520 498 / 2e-174 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G069700 [exp] 53 / 6e-09 AT3G16520 361 / 2e-122 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G070900 [exp] 50 / 5e-08 AT3G16520 478 / 2e-166 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G070000 [exp] 50 / 5e-08 AT3G16520 474 / 4e-165 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G071000 [exp] 49 / 2e-07 AT3G16520 485 / 2e-169 UDP-glucosyl transferase 88A1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014949 pacid=23152740 polypeptide=Lus10014949 locus=Lus10014949.g ID=Lus10014949.BGIv1.0 annot-version=v1.0 ATGGCGGCTGCGACACCTACTTCGAATCGATCTCCGCCGCATTCCCTTCAATCACTCTCCAACCTCCGCGATCTCCTCTCCGATCTTTCCGGATCCAAGA GGATCAAAGCCCTGGTCGTCGATTTCTTCTGCAAATCCGCCGTCAGAGATGCCGGGGTGGTTTTGGAGCTTAAGATGGAGGAGCCACGAAATGGGGTCAC AGTGAACGCTGACGAGCTAGCAAAACGAATCGTCGAACTAATGACGAACTCGGCGAGAGGGAAAGCAATTAGAGATCGAGTCACGAGCATGAAGGAAGCT GCCGCGGAGGCAGCGAGTGTTAACGGCTCGTCTCACGTTGCCGTTACGAAGCTTGTTGAGTCATTTAAACGAGCCTAG
AA sequence Show only first row Show all	>Lus10014949 pacid=23152740 polypeptide=Lus10014949 locus=Lus10014949.g ID=Lus10014949.BGIv1.0 annot-version=v1.0 MAAATPTSNRSPPHSLQSLSNLRDLLSDLSGSKRIKALVVDFFCKSAVRDAGVVLELKMEEPRNGVTVNADELAKRIVELMTNSARGKAIRDRVTSMKEA AAEAASVNGSSHVAVTKLVESFKRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014949 [exp]	0	1
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004687 [exp]	9.4	0.9677
					Lus10038209 [exp]	13.3	0.9670
AT5G23570		SGS3, ATSGS3	SUPPRESSOR OF GENE SILENCING 3...		Lus10026697 [exp]	15.6	0.9661
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10040256 [exp]	19.0	0.9629
AT2G48020			Major facilitator superfamily ...		Lus10027977 [exp]	19.7	0.9613
AT5G56510		APUM12	pumilio 12 (.1)		Lus10024793 [exp]	20.7	0.9168
					Lus10001854 [exp]	21.8	0.9615
AT4G37790	HD	HAT22	Homeobox-leucine zipper protei...		Lus10027633 [exp]	24.3	0.7889
AT2G21650	MYB	RSM1, ATRL2, ME...	RADIALIS-LIKE SANT/MYB 1, MATE...		Lus10040453 [exp]	26.3	0.9604
AT3G26790	B3	FUS3	FUSCA 3, AP2/B3-like transcrip...		Lus10012573 [exp]	27.4	0.9355

Compare expression of checked genes

Lus10014949 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.