Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014959 pacid=23152725 polypeptide=Lus10014959 locus=Lus10014959.g ID=Lus10014959.BGIv1.0 annot-version=v1.0 ATGGCTGAGAAGTGTCCTGGACATCCTGGAACTGTTGAAATCCTGGATTTCAAACCTTCCCTGCACGAGACGAGGAGGAAGAAGAAGAAGCCGGGGGAGC GGCGGTGGTCGGAGGCGGAGGATTTTCCGCCTGGAATCAAGTTCGAGCTAGAAGGCAGAGGTTAG
AA sequence Show only first row Show all	>Lus10014959 pacid=23152725 polypeptide=Lus10014959 locus=Lus10014959.g ID=Lus10014959.BGIv1.0 annot-version=v1.0 MAEKCPGHPGTVEILDFKPSLHETRRKKKKPGERRWSEAEDFPPGIKFELEGRG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014959 [exp]	0	1
AT4G13270			Late embryogenesis abundant (L...		Lus10043216 [exp]	5.9	0.7807
AT1G08370		DCP1, ATDCP1	decapping 1 (.1)		Lus10017007 [exp]	6.9	0.7060
AT1G78310			VQ motif-containing protein (....		Lus10036479 [exp]	15.6	0.7464
AT4G25680			PPPDE putative thiol peptidase...		Lus10014960 [exp]	17.9	0.7599
AT2G34050			unknown protein		Lus10020428 [exp]	18.5	0.6814
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10028280 [exp]	18.8	0.7503
AT5G48385			FRIGIDA-like protein (.1)		Lus10001723 [exp]	20.1	0.6827
AT2G39370		MAKR4	MEMBRANE-ASSOCIATED KINASE REG...		Lus10030311 [exp]	22.7	0.7147
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Lus10002410 [exp]	27.7	0.7389
AT5G22950		VPS24.1	SNF7 family protein (.1)		Lus10021423 [exp]	31.1	0.7451

Compare expression of checked genes

Lus10014959 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.