Lus10014960 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25680 313 / 7e-109 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 309 / 3e-107 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 91 / 3e-22 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 84 / 1e-19 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 84 / 1e-19 PPPDE putative thiol peptidase family protein (.1)
AT5G47310 81 / 2e-18 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 80 / 5e-18 PPPDE putative thiol peptidase family protein (.1.2)
AT1G47740 81 / 6e-18 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 81 / 2e-17 unknown protein
AT3G07090 52 / 9e-08 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038841 426 / 2e-153 AT4G25680 343 / 2e-120 PPPDE putative thiol peptidase family protein (.1)
Lus10027510 372 / 2e-131 AT4G25680 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1)
Lus10039275 367 / 9e-130 AT4G25680 348 / 6e-122 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 95 / 1e-23 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 94 / 2e-23 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10007844 90 / 1e-21 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 88 / 4e-21 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 85 / 1e-19 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10005341 84 / 1e-19 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G143132 357 / 9e-126 AT4G25680 331 / 2e-115 PPPDE putative thiol peptidase family protein (.1)
Potri.004G079800 352 / 7e-124 AT4G25680 339 / 1e-118 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 92 / 1e-22 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.006G261500 91 / 4e-22 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 88 / 5e-21 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 85 / 5e-20 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 84 / 2e-19 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 83 / 3e-19 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.009G113168 77 / 6e-17 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 77 / 6e-17 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10014960 pacid=23152737 polypeptide=Lus10014960 locus=Lus10014960.g ID=Lus10014960.BGIv1.0 annot-version=v1.0
ATGACGGATGTCGTATTGCACATATACGACGTGACGAACAGTGGATCGGAGAAGACGAACAGTACGATCATGCAGATCAACAAGATCTTCAAGGACGGAA
TTGGCATCGGCGGCATCTTCCACAGTGCTGTTCAGGTCTATGGAGAAGATGAGTGGTCTTTCGGCTTTTGTGAACGAGGAACTGGAGTGTTCAGTTGCCC
TTCTGGGAAGAATCCAATGTATACGTACCGTGAAAGCATCATCCTTGGAAAAACCAGCTTCTCAATCTCTAAAGTGAACCAGATCCTGCGTGAATTCAGT
AGGGAATGGCCCGGAAGTGCTTACGATTTGTTAGGCAAGAACTGTAATCACTTCTGTGATGAGTTCTGTGAGAAGTTAGGTGTACCGAAACTTCCAGGTT
GGATTAACCGGTTTGCCAATGCTGGCGATGCAGCTGTCGAAATAGCTGGAAACACTGCCGTACGATTCAGGCAAGCGAAAACCGAGATCATAACAGCTAG
TAAAGTAGCCTATCGTTTCCTGTTGGGTGTTGGATCCAACAACGGTACTACTGGCAACTCTCCTGGCAACTCCCCTGGGTCTCCAAGGATTCAAGCAACA
TGGTTCAAGAACCTCGTCACCAACGGTGCGAAACCATCTACCAGTACAGAAATAGACTCTCCGCAACAGCAGAAGAAGTCTCGACAAGAGGAGTCGGATA
GGCTACTACTGTAA
AA sequence
>Lus10014960 pacid=23152737 polypeptide=Lus10014960 locus=Lus10014960.g ID=Lus10014960.BGIv1.0 annot-version=v1.0
MTDVVLHIYDVTNSGSEKTNSTIMQINKIFKDGIGIGGIFHSAVQVYGEDEWSFGFCERGTGVFSCPSGKNPMYTYRESIILGKTSFSISKVNQILREFS
REWPGSAYDLLGKNCNHFCDEFCEKLGVPKLPGWINRFANAGDAAVEIAGNTAVRFRQAKTEIITASKVAYRFLLGVGSNNGTTGNSPGNSPGSPRIQAT
WFKNLVTNGAKPSTSTEIDSPQQQKKSRQEESDRLLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25680 PPPDE putative thiol peptidase... Lus10014960 0 1
AT1G61620 phosphoinositide binding (.1) Lus10018409 5.6 0.8926
AT3G12620 Protein phosphatase 2C family ... Lus10030302 9.7 0.8393
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10014942 9.9 0.8554
AT5G16790 AtTHO7 Tho complex subunit 7/Mft1p (.... Lus10030532 16.8 0.7909
Lus10014959 17.9 0.7599
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10040121 17.9 0.7912
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10028280 18.9 0.8116
AT4G25680 PPPDE putative thiol peptidase... Lus10038841 19.5 0.8773
AT1G78310 VQ motif-containing protein (.... Lus10036479 21.2 0.8014
AT3G43850 unknown protein Lus10038073 25.6 0.8372

Lus10014960 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.