Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30790 46 / 2e-06 F-box and associated interaction domains-containing protein (.1) AT1G33530 45 / 3e-06 F-box family protein (.1) AT5G62660 44 / 7e-06 F-box and associated interaction domains-containing protein (.1) AT1G47790 44 / 1e-05 F-box and associated interaction domains-containing protein (.1) AT1G15015 43 / 1e-05 F-box family protein (.1) AT5G10340 43 / 2e-05 F-box family protein (.1) AT1G50870 43 / 2e-05 F-box and associated interaction domains-containing protein (.1) AT3G10240 43 / 2e-05 F-box and associated interaction domains-containing protein (.1) AT5G16285 41 / 2e-05 F-box family protein (.1) AT1G47765 43 / 3e-05 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038864 [exp] 136 / 1e-42 AT1G47790 50 / 2e-08 F-box and associated interaction domains-containing protein (.1) Lus10014979 [exp] 90 / 3e-22 AT1G33530 57 / 6e-09 F-box family protein (.1) Lus10041462 [exp] 66 / 6e-14 AT1G30790 47 / 3e-07 F-box and associated interaction domains-containing protein (.1) Lus10034309 [exp] 67 / 1e-13 AT4G38870 84 / 4e-18 F-box and associated interaction domains-containing protein (.1) Lus10016866 [exp] 64 / 2e-12 AT1G32420 84 / 2e-17 F-box and associated interaction domains-containing protein (.1) Lus10011197 [exp] 61 / 2e-11 AT1G47790 86 / 6e-18 F-box and associated interaction domains-containing protein (.1) Lus10011200 [exp] 60 / 2e-11 AT1G47790 84 / 2e-18 F-box and associated interaction domains-containing protein (.1) Lus10026616 [exp] 60 / 3e-11 AT1G47790 77 / 1e-15 F-box and associated interaction domains-containing protein (.1) Lus10007277 [exp] 59 / 9e-11 AT3G04660 82 / 6e-17 F-box and associated interaction domains-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G170300 [exp] 45 / 3e-06 AT4G12560 69 / 1e-12 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.013G093100 [exp] 45 / 3e-06 AT1G50870 80 / 2e-16 F-box and associated interaction domains-containing protein (.1) Potri.001G318400 [exp] 45 / 4e-06 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.008G216000 [exp] 44 / 7e-06 AT1G47340 65 / 9e-12 F-box and associated interaction domains-containing protein (.1) Potri.008G199601 [exp] 42 / 7e-06 AT3G06240 61 / 2e-12 F-box family protein (.1) Potri.008G199800 [exp] 44 / 1e-05 AT3G23880 182 / 3e-53 F-box and associated interaction domains-containing protein (.1) Potri.008G215800 [exp] 44 / 1e-05 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1) Potri.017G058000 [exp] 44 / 1e-05 AT3G06240 138 / 5e-37 F-box family protein (.1) Potri.001G458400 [exp] 44 / 1e-05 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1) Potri.006G012900 [exp] 43 / 2e-05 AT4G12560 144 / 2e-39 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10014984 pacid=23152827 polypeptide=Lus10014984 locus=Lus10014984.g ID=Lus10014984.BGIv1.0 annot-version=v1.0 ATGATATCTGTTTATCAAAGTATCAGTTCAATTGCTGTCGACGAAGATGTGTTGGTTTACCAGATTCTCACCAGACTCTCAGTGAAATCGCTGATGAAAT TCAAATGCGTCTCGAAAGGTTGGAAATCCACCATCGAGACAGATCCGCACTTCATCGATTTACACTGCATTCTTGGATCGATACGTGAAAGGAAACCCCC TACTCTTGCTGTTATCACCACCTCTTCTTCCAAGGCCAAGAATCACGAGGTGGAATTGATCCTCCCCGTCGGCGAAGGGGAAGGTTTCGCGATTAGAGAG CTCGAACTACCCACTCGAGACGACGAGATGGACTTGGCCGATGCCATTGAGTTGGCATTTCGTGATTTATATCCGAGAAGCAGGTACCACCGTGTCATTG AAGAGTTCTAG
AA sequence Show only first row Show all	>Lus10014984 pacid=23152827 polypeptide=Lus10014984 locus=Lus10014984.g ID=Lus10014984.BGIv1.0 annot-version=v1.0 MISVYQSISSIAVDEDVLVYQILTRLSVKSLMKFKCVSKGWKSTIETDPHFIDLHCILGSIRERKPPTLAVITTSSSKAKNHEVELILPVGEGEGFAIRE LELPTRDDEMDLADAIELAFRDLYPRSRYHRVIEEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G33530			F-box family protein (.1)		Lus10014984 [exp]	0	1
AT1G24735			S-adenosyl-L-methionine-depend...		Lus10021804 [exp]	4.9	0.9659
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	7.1	0.9646
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014057 [exp]	8.4	0.9030
					Lus10023587 [exp]	8.7	0.9646
					Lus10007927 [exp]	10.0	0.9646
AT3G19540			Protein of unknown function (D...		Lus10028040 [exp]	11.2	0.9646
					Lus10021782 [exp]	12.2	0.9646
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10039026 [exp]	13.2	0.9646
AT1G48120			hydrolases;protein serine/thre...		Lus10015869 [exp]	14.1	0.9646
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10014730 [exp]	14.1	0.8652

Compare expression of checked genes

Lus10014984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.