Lus10014986 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25570 241 / 3e-79 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 151 / 2e-44 ACYB-1 cytochrome B561-1 (.1)
AT1G26100 107 / 2e-27 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 91 / 1e-21 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT3G14830 45 / 6e-05 unknown protein
AT1G53450 42 / 0.0003 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038866 324 / 2e-112 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 282 / 1e-95 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 263 / 1e-87 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 130 / 4e-37 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10034074 129 / 3e-35 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10034427 110 / 5e-29 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 106 / 2e-27 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10021715 92 / 9e-22 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 84 / 4e-19 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G143700 262 / 6e-88 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 254 / 1e-84 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.017G111700 159 / 1e-47 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.004G103800 157 / 8e-47 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 146 / 1e-42 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.008G138300 112 / 2e-29 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 111 / 4e-29 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 110 / 7e-29 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 105 / 1e-26 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.001G386700 50 / 7e-07 AT3G14830 586 / 0.0 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10014986 pacid=23152823 polypeptide=Lus10014986 locus=Lus10014986.g ID=Lus10014986.BGIv1.0 annot-version=v1.0
ATGCATTGGTGGTGTTTGGGGGGGCTGTTCGATGAAACTGAAGCATTGGTGTTTGGGGGGATGTCATTGCAGATTGGCAGGTCGAAGTGGAACGGTAACG
TCGGTAGTTCTGGGATCGTTTTGAGAGTGGAGAGCCCTCTCTCGTCGGGTGTTAGCCAGCCTTTCTTACTTGCAGTCAAATCTCCATTTCTGAAACAGAG
TAAAAAGAAGAAGAAGATGGGTTTAGGTGTAAAGGCGTTACCTTTCACTTACGTGGCGCACGCGATCGCCGTGGTGGCAGCGGTCATGGTTCTGGTCTGG
TGCATTAGCTTCAGAGGCGGCTTAGCTTGGGAAGATACCAACAAAAACCTCATCTTCAATCTTCATCCAGTGCTGATGCTGATCGGCCTCATCATCATAG
GAGGCGAAGCAATCATAAGCTACAAGTCTCTGCCACTGGAGAAGGAAACGAAGAAGCTGATCCACCTCGCCCTCCATGCTGTCGCGCTCGTTCTAGGCAT
CGTCGGGATCTACACTGCTTTCAAGTTCCACAACGAGAGCGGCATTGCCAATCTCTACAGCTTGCACTCCTGGCTCGGCATCCTCGTCATCTCCCTCTAC
GGCATCCAGTGGATCTACGGCTTCATAATCTTCTTCTACCCGGGCGGATCGAACACCCTGCGGAGCGCATCCCTGCCGTGGCACGTCCTCCTCGGCCTCT
TCGCGTACATACTAGCGGTCGGAACTGCTGCCCTCGGGTTCCTCGAGAAGCTAACCTTCCTCCAGAACTCGGGCCTCGCCAAGTATGGCTCTGAGGCCCT
GCTCGTGAACTTCACAGCAGTGGTCACGATTCTTTACGGCGCATTCGTCATACTGTCAGTGGCCGGGGACCGGAGCCAGGCTCCGGATGACTACAGCTAC
TCGGCTATCTAA
AA sequence
>Lus10014986 pacid=23152823 polypeptide=Lus10014986 locus=Lus10014986.g ID=Lus10014986.BGIv1.0 annot-version=v1.0
MHWWCLGGLFDETEALVFGGMSLQIGRSKWNGNVGSSGIVLRVESPLSSGVSQPFLLAVKSPFLKQSKKKKKMGLGVKALPFTYVAHAIAVVAAVMVLVW
CISFRGGLAWEDTNKNLIFNLHPVLMLIGLIIIGGEAIISYKSLPLEKETKKLIHLALHAVALVLGIVGIYTAFKFHNESGIANLYSLHSWLGILVISLY
GIQWIYGFIIFFYPGGSNTLRSASLPWHVLLGLFAYILAVGTAALGFLEKLTFLQNSGLAKYGSEALLVNFTAVVTILYGAFVILSVAGDRSQAPDDYSY
SAI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10014986 0 1
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10038866 1.4 0.8815
AT2G43250 unknown protein Lus10040469 4.7 0.8009
AT3G57990 unknown protein Lus10012013 5.3 0.7933
AT3G02910 AIG2-like (avirulence induced ... Lus10040635 6.7 0.7991
AT1G07510 FTSH10 FTSH protease 10 (.1) Lus10004972 6.9 0.7667
AT4G35220 Cyclase family protein (.1) Lus10014092 13.4 0.7918
AT5G16370 AAE5 acyl activating enzyme 5 (.1) Lus10039161 15.2 0.7730
AT3G62580 Late embryogenesis abundant pr... Lus10010016 16.2 0.7756
AT1G17100 SOUL heme-binding family prote... Lus10042093 19.1 0.7810
AT3G54680 proteophosphoglycan-related (.... Lus10033654 19.5 0.7239

Lus10014986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.