Plant FIBer expression Database

Lus10014995 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46030 66 / 4e-15 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015293
[exp]
62 / 2e-12 AT5G46030 154 / 2e-46 unknown protein
Lus10025438
[exp]
50 / 8e-09 AT5G46030 127 / 8e-40 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G056000
[exp]
68 / 3e-16 AT5G46030 92 / 1e-25 unknown protein
Potri.001G373400
[exp]
66 / 2e-15 AT5G46030 122 / 1e-37 unknown protein
Potri.011G097300
[exp]
66 / 4e-15 AT5G46030 146 / 3e-47 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF05129 Elf1 Transcription elongation factor Elf1 like
Representative CDS sequence
>Lus10014995 pacid=23152756 polypeptide=Lus10014995 locus=Lus10014995.g ID=Lus10014995.BGIv1.0 annot-version=v1.0
ATGGGGAAGCGGAAGTCGTCGGCGTCCAAGAAGATGAACGCGAAGAAACCTCGAATCGAGAAGCTCGACGAGGAATTCGAATGCCCCTTCTGCAACTACC
CCAAGAGCGTTGCTTGCACTTTCTCCGAGGACAGCGCCGAGGTCCGCTGCTACGTCTGCGATGAGCACTACGTGATCGATAAGACCCCTTTGACGGAGGC
CATCGACGTCTACTCGGAGTGGATCGATGCCTGTGTCGAAGTCAACAAAAAGGAAGAAGAGCCAGAAGAAGAAGAGGATGAGGATGAAGGTTGGTTTGGT
GAATTTGGTCATCGTCGGCAGAAGATCAGAGGATTCCGATCGCCTTCGGCGAGTGTTAGTCATTAA
AA sequence
>Lus10014995 pacid=23152756 polypeptide=Lus10014995 locus=Lus10014995.g ID=Lus10014995.BGIv1.0 annot-version=v1.0
MGKRKSSASKKMNAKKPRIEKLDEEFECPFCNYPKSVACTFSEDSAEVRCYVCDEHYVIDKTPLTEAIDVYSEWIDACVEVNKKEEEPEEEEDEDEGWFG
EFGHRRQKIRGFRSPSASVSH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46030 unknown protein Lus10014995
[exp]
0 1
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10006119
[exp]
3.6 0.9137
AT2G15220 Plant basic secretory protein ... Lus10019804
[exp]
5.3 0.8889
AT1G31720 Protein of unknown function (D... Lus10034746
[exp]
5.9 0.8952
AT1G77760 GNR1, NIA1 nitrate reductase 1 (.1) Lus10031005
[exp]
7.1 0.8229
AT1G48820 Terpenoid cyclases/Protein pre... Lus10008613
[exp]
10.0 0.8543
AT5G43500 ATARP9 actin-related protein 9 (.1.2) Lus10021206
[exp]
11.5 0.8696
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10016178
[exp]
15.9 0.9076
AT5G13530 KEG KEEP ON GOING, protein kinases... Lus10020272
[exp]
20.9 0.8454
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10018143
[exp]
21.8 0.8209
AT2G27410 B3 Domain of unknown function (DU... Lus10027286
[exp]
22.7 0.8905

Lus10014995 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.