Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62065 114 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 52 / 6e-09 LTP6 lipid transfer protein 6 (.1.2) AT2G45570 55 / 1e-08 CYP76C2 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) AT2G45580 54 / 3e-08 CYP76C3 "cytochrome P450, family 76, subfamily C, polypeptide 3", cytochrome P450, family 76, subfamily C, polypeptide 3 (.1) AT2G45560 53 / 3e-08 CYP76C1 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) AT5G01870 49 / 1e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45550 50 / 5e-07 CYP76C4 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) AT5G25130 46 / 7e-06 CYP71B12 "cytochrome P450, family 71, subfamily B, polypeptide 12", cytochrome P450, family 71, subfamily B, polypeptide 12 (.1) AT3G51600 44 / 9e-06 LTP5 lipid transfer protein 5 (.1) AT3G26190 45 / 1e-05 CYP71B21 "cytochrome P450, family 71, subfamily B, polypeptide 21", cytochrome P450, family 71, subfamily B, polypeptide 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027430 [exp] 81 / 1e-17 AT2G45550 270 / 2e-85 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10027425 [exp] 75 / 2e-15 AT3G61040 352 / 1e-116 "cytochrome P450, family 76, subfamily C, polypeptide 7", cytochrome P450, family 76, subfamily C, polypeptide 7 (.1.2) Lus10005766 [exp] 73 / 6e-15 AT3G61040 352 / 2e-116 "cytochrome P450, family 76, subfamily C, polypeptide 7", cytochrome P450, family 76, subfamily C, polypeptide 7 (.1.2) Lus10027428 [exp] 72 / 1e-14 AT2G45560 360 / 2e-119 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) Lus10006323 [exp] 68 / 4e-13 AT1G33720 371 / 1e-123 "cytochrome P450, family 76, subfamily C, polypeptide 6", cytochrome P450, family 76, subfamily C, polypeptide 6 (.1) Lus10027426 [exp] 68 / 4e-13 AT2G45570 334 / 2e-109 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) Lus10005767 [exp] 67 / 1e-12 AT2G45550 338 / 1e-110 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10005765 [exp] 63 / 1e-11 AT2G45550 374 / 9e-125 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10040353 [exp] 62 / 3e-11 AT2G45570 350 / 1e-115 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G139700 [exp] 139 / 1e-42 AT5G62065 101 / 6e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G136800 [exp] 100 / 3e-24 AT2G45560 370 / 2e-123 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) Potri.012G136600 [exp] 100 / 4e-24 AT2G45560 360 / 3e-119 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) Potri.015G142100 [exp] 81 / 4e-20 AT5G62065 62 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G109300 [exp] 76 / 5e-16 AT1G33720 363 / 1e-120 "cytochrome P450, family 76, subfamily C, polypeptide 6", cytochrome P450, family 76, subfamily C, polypeptide 6 (.1) Potri.015G138900 [exp] 71 / 2e-14 AT1G33720 359 / 6e-119 "cytochrome P450, family 76, subfamily C, polypeptide 6", cytochrome P450, family 76, subfamily C, polypeptide 6 (.1) Potri.012G137200 [exp] 67 / 1e-12 AT2G45550 374 / 1e-124 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.001G025200 [exp] 59 / 3e-10 AT2G45550 322 / 2e-104 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.001G232900 [exp] 53 / 5e-09 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 51 / 2e-08 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014998 pacid=23152736 polypeptide=Lus10014998 locus=Lus10014998.g ID=Lus10014998.BGIv1.0 annot-version=v1.0 ATGTGCTTACTCGGAATTCCGGCTAAGGCATTGATGCCACTACTACTCGCACTCGCCGTGGCGGCGGCCGCAATGCCGGCGGAGGACTGCTCCACCGTGA CGGGGCTGATCTCGGCGTGCACTTCCTTCATCACATACGGCTCGCCGGACCCACTCCCGGGCTCGCCGTGCTGCGACGGGATGTCGACGTTGGGCACGGT GGTGGACTCCGGTGGCAGCGGGGCCGCCGTGTGTAGGTGCCTAATGGGCCTAATTGCAACGTACAATCCGAACGCTACGGCCATTGCTACTCTCCCGGGC TTTTGTGGGATCGATATGGGCTTCATCATTGACCCAAACACTGATTGCTCCAACTACATCCTATCCTTTGGAGGAGAAGGAAGCAATTTGATTTACAGAA TCTTCCATCGGCAACCTTTTCATGTGGGGTTCCATGGCCCAATCATGTCCCTCCGGTTTGGAAACCGGACTGTGGTCGTGGGATCTACACCTGAAGCAGC CAGTGAAATCTTAAGAGTCCACGACCATGATTTGTCAGGACGTTTTGTCCCCCGCGTCTCGTTTGCTACGGATCCTGATCTGAACCAGGACTCGATGGCA TGGTCCGTCCAATGCTCGGACACGTGGCGGATCATGCGCTTCATGGTCTGA
AA sequence Show only first row Show all	>Lus10014998 pacid=23152736 polypeptide=Lus10014998 locus=Lus10014998.g ID=Lus10014998.BGIv1.0 annot-version=v1.0 MCLLGIPAKALMPLLLALAVAAAAMPAEDCSTVTGLISACTSFITYGSPDPLPGSPCCDGMSTLGTVVDSGGSGAAVCRCLMGLIATYNPNATAIATLPG FCGIDMGFIIDPNTDCSNYILSFGGEGSNLIYRIFHRQPFHVGFHGPIMSLRFGNRTVVVGSTPEAASEILRVHDHDLSGRFVPRVSFATDPDLNQDSMA WSVQCSDTWRIMRFMV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62065			Bifunctional inhibitor/lipid-t...		Lus10014998 [exp]	0	1

Compare expression of checked genes

Lus10014998 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.