Lus10015000 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04630 209 / 9e-71 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1)
AT5G51940 208 / 2e-70 NRPE6A, NRPD6A, NRPB6A RNA polymerase Rpb6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038878 284 / 2e-100 AT2G04630 209 / 8e-71 RNA polymerase Rpb6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G138800 242 / 1e-83 AT5G51940 197 / 7e-66 RNA polymerase Rpb6 (.1)
Potri.012G136900 202 / 5e-68 AT5G51940 210 / 4e-71 RNA polymerase Rpb6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Representative CDS sequence
>Lus10015000 pacid=23152817 polypeptide=Lus10015000 locus=Lus10015000.g ID=Lus10015000.BGIv1.0 annot-version=v1.0
ATGGCGGATGACGATTACAACGAAATGGACATGGGATACGAGGATGAGCCAGCTGAGCCCGATGTCGAAGAAGGAGCCGAACCAGAGGCGGATAACGAGA
ACGGGGAGGATGTTACAGGGGAACCCATTGAAACGGATGACAGGGAGGATCCGGATGCAGTGGAGAGATCAGCTCGGAAGACGTCCAAGTATATGACCAA
GTACGAGCGTGCCAGGATTTTGGGGACTCGAGCTCTGCAGATTAGCATGAATGCTCCTGTGATGGTGGAGTTGGAGGGTGAGACTGATCCATTGGAGATC
GCCATGAAGGAGCTTCGACAGCGAAAGATACCTTTCACCATCCGCCGGTACCTGCCTGATGGAAGCTACGAAGACTGGGGAGTCGACGAGCTGATCGTTG
AAGACTCGTGGAAGAGGCAGGTCGGAGGGGACTAA
AA sequence
>Lus10015000 pacid=23152817 polypeptide=Lus10015000 locus=Lus10015000.g ID=Lus10015000.BGIv1.0 annot-version=v1.0
MADDDYNEMDMGYEDEPAEPDVEEGAEPEADNENGEDVTGEPIETDDREDPDAVERSARKTSKYMTKYERARILGTRALQISMNAPVMVELEGETDPLEI
AMKELRQRKIPFTIRRYLPDGSYEDWGVDELIVEDSWKRQVGGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10015000 0 1
AT3G22660 rRNA processing protein-relate... Lus10037050 1.0 0.9399
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10038878 2.2 0.9248
AT4G28360 Ribosomal protein L22p/L17e fa... Lus10037603 2.4 0.9261
AT3G56210 ARM repeat superfamily protein... Lus10017416 4.7 0.9275
AT4G20150 unknown protein Lus10036250 4.9 0.9115
AT1G07170 PHF5-like protein (.1.2.3) Lus10040654 5.6 0.8932
AT5G56670 Ribosomal protein S30 family p... Lus10017473 5.9 0.9188
AT5G49210 unknown protein Lus10037138 6.9 0.8960
AT5G13070 MSF1-like family protein (.1) Lus10031261 7.1 0.8808
AT5G23535 KOW domain-containing protein ... Lus10022069 8.1 0.9242

Lus10015000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.