Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51980 122 / 7e-35 C3HZnF Transducin/WD40 repeat-like superfamily protein (.1.2) AT4G25440 115 / 3e-32 C3HZnF ZFWD1 zinc finger WD40 repeat protein 1 (.1) AT5G40880 89 / 4e-22 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1) AT5G49200 84 / 2e-20 C3HZnF WD-40 repeat family protein / zfwd4 protein (ZFWD4) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038890 [exp] 158 / 8e-49 AT5G51980 551 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10032062 [exp] 84 / 1e-20 AT4G25440 212 / 3e-65 zinc finger WD40 repeat protein 1 (.1) Lus10001652 [exp] 81 / 3e-20 AT5G51980 192 / 2e-59 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10004085 [exp] 79 / 5e-20 AT4G25440 145 / 1e-42 zinc finger WD40 repeat protein 1 (.1) Lus10032066 [exp] 81 / 2e-19 AT4G25440 343 / 5e-115 zinc finger WD40 repeat protein 1 (.1) Lus10014598 [exp] 80 / 2e-19 AT4G25440 134 / 2e-36 zinc finger WD40 repeat protein 1 (.1) Lus10014612 [exp] 80 / 3e-19 AT5G40880 131 / 3e-35 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1) Lus10014595 [exp] 81 / 4e-19 AT5G14250 445 / 3e-150 FUSCA 11, COP9 SIGNALOSOME SUBUNIT 3, CONSTITUTIVE PHOTOMORPHOGENIC 13, Proteasome component (PCI) domain protein (.1), Proteasome component (PCI) domain protein (.2) Lus10021656 [exp] 78 / 3e-18 AT4G25440 329 / 9e-109 zinc finger WD40 repeat protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G137200 [exp] 135 / 2e-39 AT4G25440 587 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.012G134800 [exp] 134 / 5e-39 AT4G25440 600 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.014G077800 [exp] 101 / 1e-26 AT5G51980 391 / 5e-132 Transducin/WD40 repeat-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10015010 pacid=23152832 polypeptide=Lus10015010 locus=Lus10015010.g ID=Lus10015010.BGIv1.0 annot-version=v1.0 ATGCAGGGACTCCTAACCCTGTGTGGAATGCATGATTTGGAAGGCAAACCGATCCTGCTATGCTCATCTAACGACAACACAGTTCGGATATACGATCTGC CATCGTTTTCGGAGAGGAGCAAGATATTCTCAAAACAGGAGATCCGGGCGATCCAGGCAGGCCCAGCAGGACTGTTCTTCACCGGGGATGGAACCGGTCA AGTCAGAGTATGGAACTGTAAAGCTGACCAACAACAGCCAGCTACTCCGGCGGCGGCCACATGA
AA sequence Show only first row Show all	>Lus10015010 pacid=23152832 polypeptide=Lus10015010 locus=Lus10015010.g ID=Lus10015010.BGIv1.0 annot-version=v1.0 MQGLLTLCGMHDLEGKPILLCSSNDNTVRIYDLPSFSERSKIFSKQEIRAIQAGPAGLFFTGDGTGQVRVWNCKADQQQPATPAAAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Lus10015010 [exp]	0	1
AT1G74470			Pyridine nucleotide-disulphide...		Lus10026772 [exp]	3.6	0.8913
AT1G27090			glycine-rich protein (.1)		Lus10037224 [exp]	11.1	0.9150
AT5G20600			unknown protein		Lus10027609 [exp]	13.0	0.9150
AT5G25940			early nodulin-related (.1)		Lus10019434 [exp]	18.0	0.9069
AT1G10580			Transducin/WD40 repeat-like su...		Lus10030620 [exp]	22.7	0.9038
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Lus10021051 [exp]	25.3	0.9041
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10036976 [exp]	28.6	0.9025
AT1G13190			RNA-binding (RRM/RBD/RNP motif...		Lus10019147 [exp]	28.7	0.8959
AT5G51830			pfkB-like carbohydrate kinase ...		Lus10027401 [exp]	30.3	0.9002
AT1G76820			eukaryotic translation initiat...		Lus10012856 [exp]	33.4	0.8922

Compare expression of checked genes

Lus10015010 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.