Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62150 100 / 3e-29 peptidoglycan-binding LysM domain-containing protein (.1) AT4G25433 92 / 1e-25 peptidoglycan-binding LysM domain-containing protein (.1) AT3G52790 87 / 7e-24 peptidoglycan-binding LysM domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031662 [exp] 102 / 1e-29 AT3G52790 112 / 4e-33 peptidoglycan-binding LysM domain-containing protein (.1) Lus10027407 [exp] 100 / 9e-29 AT3G52790 115 / 2e-34 peptidoglycan-binding LysM domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G137500 [exp] 102 / 9e-30 AT4G25433 113 / 7e-34 peptidoglycan-binding LysM domain-containing protein (.1) Potri.010G231000 [exp] 100 / 4e-29 AT3G52790 119 / 3e-36 peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G077900 [exp] 100 / 1e-28 AT4G25433 108 / 7e-32 peptidoglycan-binding LysM domain-containing protein (.1) Potri.002G152600 [exp] 97 / 2e-27 AT5G62150 100 / 1e-28 peptidoglycan-binding LysM domain-containing protein (.1) Potri.012G135100 [exp] 96 / 2e-27 AT4G25433 108 / 5e-32 peptidoglycan-binding LysM domain-containing protein (.1) Potri.008G030200 [exp] 95 / 5e-27 AT3G52790 114 / 1e-34 peptidoglycan-binding LysM domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0187 [flax] [poplar] LysM PF01476 [flax] [poplar] LysM LysM domain
Representative CDS sequence Show only first row Show all	>Lus10015011 pacid=23152773 polypeptide=Lus10015011 locus=Lus10015011.g ID=Lus10015011.BGIv1.0 annot-version=v1.0 ATGGCCACAACTCGACCCTTCACGGCGATCGCAACAATTCTGGTGGCGATGCTGATACTGACGGCGGCGCCGGCGGCAGAGGCGGCGCAGCTGGGAAACA GAGCCTGCGAGGAGATTTACGTTGTCGGAGAAGGAGAGACGCTGAACACGATCAGCGACAAGTGTGGCGACCCGTTTATCGTGGAGGAGAACCCGCATAT CCACGACCCGGATGACGTGTTCCCCGGCTTAGTTATCAAGATCACACCTTTCATCGTCTCTAGGTAG
AA sequence Show only first row Show all	>Lus10015011 pacid=23152773 polypeptide=Lus10015011 locus=Lus10015011.g ID=Lus10015011.BGIv1.0 annot-version=v1.0 MATTRPFTAIATILVAMLILTAAPAAEAAQLGNRACEEIYVVGEGETLNTISDKCGDPFIVEENPHIHDPDDVFPGLVIKITPFIVSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62150			peptidoglycan-binding LysM dom...		Lus10015011 [exp]	0	1
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10031388 [exp]	1.0	0.9875
AT3G11920			glutaredoxin-related (.1)		Lus10030563 [exp]	3.5	0.9806
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10013594 [exp]	3.9	0.9780
AT1G11300			protein serine/threonine kinas...		Lus10023391 [exp]	5.2	0.9795
AT2G23770			protein kinase family protein ...		Lus10000577 [exp]	5.5	0.9757
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10035241 [exp]	6.0	0.9730
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10008392 [exp]	6.5	0.9592
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10038983 [exp]	8.4	0.9699
AT5G62790		PDE129, DXR	PIGMENT-DEFECTIVE EMBRYO 129, ...		Lus10002379 [exp]	8.4	0.9723
AT1G49670		NQR	ARP protein (REF) (.1), ARP pr...		Lus10027904 [exp]	8.5	0.9710

Compare expression of checked genes

Lus10015011 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.