Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51880 100 / 2e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038893 [exp] 119 / 9e-35 AT5G51880 310 / 3e-107 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G135300 [exp] 98 / 1e-26 AT5G51880 322 / 3e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G133100 [exp] 96 / 1e-25 AT5G51880 211 / 7e-68 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015014 pacid=23152751 polypeptide=Lus10015014 locus=Lus10015014.g ID=Lus10015014.BGIv1.0 annot-version=v1.0 ATGGAGCCTCTAGTCGGAGGGGAAACCGTGTTCTATGGTGGCTGGAGGAACAATGTTGTAGCCGAGGTGGTTTCTCTTTCCCTGTTTACTTTCGGTTTTG ATTCGGTTTGCTTAAAGATTCACCGAGTTACGGAAAAGAAAATGCAGGTGGCTCCAGCGGAAGGGATGGCTCTGTTCCACATTCACGGCGACAAATGCAT GCTGCACGAAGCGAGGAATGTGACGAAAGGCGTCAAGTATGTGTTCCGGTCCGATGTCGTCTTTGCTTGA
AA sequence Show only first row Show all	>Lus10015014 pacid=23152751 polypeptide=Lus10015014 locus=Lus10015014.g ID=Lus10015014.BGIv1.0 annot-version=v1.0 MEPLVGGETVFYGGWRNNVVAEVVSLSLFTFGFDSVCLKIHRVTEKKMQVAPAEGMALFHIHGDKCMLHEARNVTKGVKYVFRSDVVFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Lus10015014 [exp]	0	1
AT4G29070			Phospholipase A2 family protei...		Lus10035314 [exp]	4.0	0.8050
AT4G11600		LSC803, PHGPX, ...	glutathione peroxidase 6 (.1)		Lus10000603 [exp]	6.7	0.7916
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	10.7	0.7980
AT3G18430			Calcium-binding EF-hand family...		Lus10022173 [exp]	12.0	0.7899
AT3G05170			Phosphoglycerate mutase family...		Lus10035350 [exp]	17.7	0.7374
AT1G26470			unknown protein		Lus10037088 [exp]	21.8	0.6318
AT5G08290		YLS8	YELLOW-LEAF-SPECIFIC GENE 8, m...		Lus10017390 [exp]	22.2	0.7716
AT4G27130			Translation initiation factor ...		Lus10031550 [exp]	27.0	0.7522
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10029234 [exp]	30.9	0.7003
AT1G67620			Lojap-related protein (.1)		Lus10015822 [exp]	33.8	0.7575

Compare expression of checked genes

Lus10015014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.