Lus10015015 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51880 106 / 2e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038893 200 / 2e-66 AT5G51880 310 / 3e-107 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G135300 129 / 1e-38 AT5G51880 322 / 3e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.012G133100 113 / 5e-32 AT5G51880 211 / 7e-68 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10015015 pacid=23152811 polypeptide=Lus10015015 locus=Lus10015015.g ID=Lus10015015.BGIv1.0 annot-version=v1.0
ATGGCGGAAGCCGGTGGCGCGAGGAAGCGAAAAGCAACAAGCGATAAGAAAGAAGCCGCCGCCGGCGTATCTAAACAACCACCGACGAGCTCGATTTGGC
CTTCGATCAAACCCAAGAAGAATCTCCAAGTCACTCGCCTCAAGGACTCCGATCTTTTCACCGTGCCGGAGTTCTTCACCTCATCCGAATCGAAGGCGTT
CATCGGAATTGCGGAGTCTAAAGGGTTCGTTCATCAGGGGAGTCTCGGACCGACGAAAGGCGAGGCTTATAGAGACAATGACAGGATCTCAGTCAACGAT
CCAGCTCTCGCTAGCTCGATTTGCTGA
AA sequence
>Lus10015015 pacid=23152811 polypeptide=Lus10015015 locus=Lus10015015.g ID=Lus10015015.BGIv1.0 annot-version=v1.0
MAEAGGARKRKATSDKKEAAAGVSKQPPTSSIWPSIKPKKNLQVTRLKDSDLFTVPEFFTSSESKAFIGIAESKGFVHQGSLGPTKGEAYRDNDRISVND
PALASSIC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51880 2-oxoglutarate (2OG) and Fe(II... Lus10015015 0 1
AT1G10600 AMSH2 associated molecule with the S... Lus10030613 5.1 0.9474
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10007727 7.7 0.9424
AT1G11260 ATSTP1, STP1 sugar transporter 1 (.1) Lus10018422 9.9 0.9169
AT5G20950 Glycosyl hydrolase family prot... Lus10013646 13.7 0.9272
AT1G21400 Thiamin diphosphate-binding fo... Lus10028648 15.5 0.9302
AT3G01640 ATGLCAK ARABIDOPSIS THALIANA GLUCURONO... Lus10022282 18.7 0.9369
AT4G32480 Protein of unknown function (D... Lus10011174 19.2 0.9394
AT5G49360 ATBXL1, BXL1 beta-xylosidase 1 (.1) Lus10016858 21.4 0.9380
AT2G43400 ETFQO electron-transfer flavoprotein... Lus10027045 23.9 0.9376
AT3G30390 Transmembrane amino acid trans... Lus10036845 25.1 0.9357

Lus10015015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.