Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45650 155 / 2e-47 MADS AGL6 AGAMOUS-like 6 (.1) AT3G61120 142 / 3e-42 MADS AGL13 AGAMOUS-like 13 (.1) AT5G15800 139 / 6e-41 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) AT1G24260 137 / 2e-40 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) AT3G02310 132 / 1e-38 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) AT1G69120 131 / 5e-38 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) AT5G60910 127 / 2e-36 MADS FUL, AGL8 FRUITFULL, AGAMOUS-like 8 (.1.2) AT1G26310 126 / 5e-36 MADS CAL1, AGL10, CAL CAULIFLOWER, AGAMOUS-like 10, K-box region and MADS-box transcription factor family protein (.1) AT2G03710 124 / 6e-36 MADS AGL3, SEP4 SEPALLATA 4, AGAMOUS-like 3, K-box region and MADS-box transcription factor family protein (.1.2.3) AT4G18960 122 / 2e-34 MADS AG AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038895 [exp] 246 / 4e-84 AT2G45650 152 / 4e-46 AGAMOUS-like 6 (.1) Lus10005080 [exp] 137 / 3e-40 AT3G02310 372 / 1e-131 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10003125 [exp] 132 / 4e-39 AT1G24260 290 / 9e-101 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10034663 [exp] 134 / 9e-39 AT5G15800 267 / 4e-90 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10003124 [exp] 132 / 5e-38 AT1G24260 355 / 6e-125 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10034371 [exp] 131 / 1e-37 AT3G02310 364 / 3e-128 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10026679 [exp] 129 / 2e-37 AT1G69120 338 / 1e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10037040 [exp] 129 / 5e-37 AT1G24260 350 / 7e-123 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10017871 [exp] 126 / 6e-37 AT1G69120 264 / 2e-90 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G134800 [exp] 179 / 3e-56 AT2G45650 209 / 2e-67 AGAMOUS-like 6 (.1) Potri.012G132600 [exp] 169 / 8e-53 AT2G45650 182 / 3e-57 AGAMOUS-like 6 (.1) Potri.014G074100 [exp] 154 / 5e-47 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1) Potri.004G115500 [exp] 135 / 9e-40 AT3G02310 357 / 4e-126 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.003G169600 [exp] 135 / 1e-39 AT1G24260 359 / 7e-127 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.001G058400 [exp] 133 / 6e-39 AT1G24260 362 / 8e-128 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.012G062300 [exp] 132 / 2e-38 AT5G60910 288 / 5e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Potri.017G099700 [exp] 132 / 2e-38 AT3G02310 372 / 8e-132 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.010G154100 [exp] 130 / 9e-38 AT1G69120 324 / 7e-113 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Potri.008G098500 [exp] 130 / 1e-37 AT1G69120 336 / 9e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01486 [flax] [poplar] K-box K-box region PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10015017 pacid=23152796 polypeptide=Lus10015017 locus=Lus10015017.g ID=Lus10015017.BGIv1.0 annot-version=v1.0 ATGGGGAGAGGGAAAGTGGTGATGAAGAGGATAGAGAACAAAGTGAACAGACAAGTCACGTTCTCCAAGAGAAGGAACGGCTTGCTTAAGAAATCCTCAG AGCTCTCTCTTCTCTGCGACGCTGAGGTCGCCCTCCTCGTCTTCTCCTGCCGCGGCAAGCTCTCCGTCTTCCCCTCCACAGAAGGAGTGAGTAAAACCCT AGTGAGGTATAGACAATGCCACTACAACAACAACCAGCAACAAGGCAGCCACATTGGTGATGAGAATGGAACACTTCAGCACTTGTGCCTAGAGGTGACC AAGCTGAAAGAGAAATGTGAATCGCTTCAAAAGTCTCACAGGCATTGCCAAGGAGAAGACATTGAGAAGCTTAGTGCCAAAGAGTTGATGAAGGTTGAGA GGAAGCTCGATCGGGCTCTCTCCCGAGCTAGGCAAAAGAAGACACAATTGATGCTACAAAAGCTAGAAGAAATGAGGAAATGGGAACAAGATCTTGGAGA AGAAAACAAGCATCTTATTGAGGTTGGTGCCATGTGTTTTGATCTTATTATCATGATAAGACACTTCTGTCATTGA
AA sequence Show only first row Show all	>Lus10015017 pacid=23152796 polypeptide=Lus10015017 locus=Lus10015017.g ID=Lus10015017.BGIv1.0 annot-version=v1.0 MGRGKVVMKRIENKVNRQVTFSKRRNGLLKKSSELSLLCDAEVALLVFSCRGKLSVFPSTEGVSKTLVRYRQCHYNNNQQQGSHIGDENGTLQHLCLEVT KLKEKCESLQKSHRHCQGEDIEKLSAKELMKVERKLDRALSRARQKKTQLMLQKLEEMRKWEQDLGEENKHLIEVGAMCFDLIIMIRHFCH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45650	MADS	AGL6	AGAMOUS-like 6 (.1)		Lus10015017 [exp]	0	1
					Lus10004634 [exp]	1.7	0.9861
AT5G10520		RBK1	ROP binding protein kinases 1 ...		Lus10002659 [exp]	2.4	0.9839
AT4G29035			Plant self-incompatibility pro...		Lus10022825 [exp]	3.2	0.9695
AT5G41020	MYB		myb family transcription facto...		Lus10022932 [exp]	3.5	0.9796
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10019783 [exp]	3.9	0.9825
AT3G05950			RmlC-like cupins superfamily p...		Lus10038456 [exp]	5.5	0.9648
					Lus10038154 [exp]	7.1	0.9368
AT3G05610			Plant invertase/pectin methyle...		Lus10020909 [exp]	7.3	0.9094
AT4G36250		ALDH3F1	aldehyde dehydrogenase 3F1 (.1...		Lus10027372 [exp]	7.4	0.9326
AT1G31670			Copper amine oxidase family pr...		Lus10010539 [exp]	7.5	0.9498

Compare expression of checked genes

Lus10015017 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.