Lus10015021 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62190 84 / 2e-19 PRH75 DEAD box RNA helicase (PRH75) (.1)
AT3G22310 48 / 1e-06 ATRH9, PMH1 RNA HELICASE 9, putative mitochondrial RNA helicase 1 (.1)
AT3G22330 47 / 3e-06 ATRH53, PMH2 putative mitochondrial RNA helicase 2 (.1)
AT5G26742 44 / 3e-05 EMB1138 embryo defective 1138, DEAD box RNA helicase (RH3) (.1), DEAD box RNA helicase (RH3) (.2), DEAD box RNA helicase (RH3) (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015020 186 / 1e-55 AT5G62190 778 / 0.0 DEAD box RNA helicase (PRH75) (.1)
Lus10038898 171 / 5e-50 AT5G62190 768 / 0.0 DEAD box RNA helicase (PRH75) (.1)
Lus10027388 105 / 1e-26 AT5G62190 804 / 0.0 DEAD box RNA helicase (PRH75) (.1)
Lus10031683 101 / 4e-25 AT5G62190 748 / 0.0 DEAD box RNA helicase (PRH75) (.1)
Lus10031012 46 / 4e-06 AT3G22330 690 / 0.0 putative mitochondrial RNA helicase 2 (.1)
Lus10035410 44 / 2e-05 AT3G22330 692 / 0.0 putative mitochondrial RNA helicase 2 (.1)
Lus10038975 44 / 4e-05 AT3G22330 639 / 0.0 putative mitochondrial RNA helicase 2 (.1)
Lus10027268 44 / 4e-05 AT3G22330 632 / 0.0 putative mitochondrial RNA helicase 2 (.1)
Lus10001057 40 / 0.0004 AT5G26742 919 / 0.0 embryo defective 1138, DEAD box RNA helicase (RH3) (.1), DEAD box RNA helicase (RH3) (.2), DEAD box RNA helicase (RH3) (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G131000 105 / 1e-26 AT5G62190 794 / 0.0 DEAD box RNA helicase (PRH75) (.1)
Potri.015G133400 86 / 5e-20 AT5G62190 785 / 0.0 DEAD box RNA helicase (PRH75) (.1)
Potri.005G000100 44 / 2e-05 AT5G26742 924 / 0.0 embryo defective 1138, DEAD box RNA helicase (RH3) (.1), DEAD box RNA helicase (RH3) (.2), DEAD box RNA helicase (RH3) (.3)
Potri.005G000500 44 / 3e-05 AT5G26742 885 / 0.0 embryo defective 1138, DEAD box RNA helicase (RH3) (.1), DEAD box RNA helicase (RH3) (.2), DEAD box RNA helicase (RH3) (.3)
Potri.016G023100 40 / 0.0007 AT3G22330 648 / 0.0 putative mitochondrial RNA helicase 2 (.1)
Potri.006G024100 39 / 0.001 AT3G22330 654 / 0.0 putative mitochondrial RNA helicase 2 (.1)
PFAM info
Representative CDS sequence
>Lus10015021 pacid=23152741 polypeptide=Lus10015021 locus=Lus10015021.g ID=Lus10015021.BGIv1.0 annot-version=v1.0
ATGCCTTCGATTGCTCTGGCTAACGATTCCATGGAGGTCAGTAACAAGAAGGAGAAGAAGATGAAGAAGCTCGCTCTCGAAGTGATGGAGACCGACACTG
AGCCGAAGAGCAAGAAGAAGGAGAAGAAGAGCAAGAGGAAGGCTGTGGAGATCGAGAGTGGAGATGACGAGGTGAAGAGCGAGACTAGCTCTGAGCTAGG
GGAGCCGGTGAATTCGAAGTCGGAGAAGAAGGCGAAGAAGGCTAAGGTTGATGAAGTTGAGGAGGAAGAGGAAGTTGTGGTGAAGGCTGATGATCCTAAT
GCTGTGGATAAATTCAGGATATCGGAGCCGCTGAAGCAGAAGCTTAAGTCCAGGGGGATTGAGGCTTTGTTTCCGATTCAGGCGATGACGTTCACTGATA
TCCTCGATGGTTGCGATTTGGTCGGCCGAGCTCGCACTGGACAGGTGACATATCGATTTCCTGTTGTCCATTTTGTAAATTTGTGCTTTGGTATGCTTGC
GTTGCATTGTCATTAA
AA sequence
>Lus10015021 pacid=23152741 polypeptide=Lus10015021 locus=Lus10015021.g ID=Lus10015021.BGIv1.0 annot-version=v1.0
MPSIALANDSMEVSNKKEKKMKKLALEVMETDTEPKSKKKEKKSKRKAVEIESGDDEVKSETSSELGEPVNSKSEKKAKKAKVDEVEEEEEVVVKADDPN
AVDKFRISEPLKQKLKSRGIEALFPIQAMTFTDILDGCDLVGRARTGQVTYRFPVVHFVNLCFGMLALHCH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62190 PRH75 DEAD box RNA helicase (PRH75) ... Lus10015021 0 1
AT1G49600 ATRBP47A RNA-binding protein 47A (.1) Lus10012071 3.5 0.8259
AT5G59500 protein C-terminal S-isoprenyl... Lus10001571 9.7 0.8087
AT2G37560 ATORC2 origin recognition complex sec... Lus10024412 14.3 0.7790
AT1G02870 unknown protein Lus10002436 20.6 0.7665
AT2G29200 APUM1 pumilio 1 (.1) Lus10001567 23.1 0.7406
AT4G10620 P-loop containing nucleoside t... Lus10016692 25.2 0.7410
AT1G62390 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1,... Lus10029481 26.8 0.7683
AT5G62050 ATOXA1, OXA1AT,... HOMOLOG OF YEAST OXIDASE ASSEM... Lus10032381 32.0 0.7487
AT3G25890 AP2_ERF CRF11 cytokinin response factor 11, ... Lus10035018 33.6 0.7703
AT5G22100 RNA cyclase family protein (.1... Lus10004092 33.7 0.7666

Lus10015021 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.