Lus10015031 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G129100 38 / 0.0006 AT1G12380 890 / 0.0 unknown protein
PFAM info
Representative CDS sequence
>Lus10015031 pacid=23152720 polypeptide=Lus10015031 locus=Lus10015031.g ID=Lus10015031.BGIv1.0 annot-version=v1.0
ATGGTTGGCTGCGAAGATGATATGCTGAACGAGGTCTTTGACGATGCTCCACCAGTGTTTTACTGGCGGCTTGAGGCTGGGTGGGATTATGAATCAGCCT
TGAGTGGACCAACTGGGTCAACCTTGGAAGCACTCAGGAGTGAATATTTGTTCTCAAAGAGCAGGCCACAACTGATTTTTAAGCACTCATTTGAACGAGA
GATACGACCTGTTGGAGCATACCTATGTTCTGCCCTCGTTTGTCCTATGTTGCAGGAATATTGGAGCAGACCGGTGATCAACGATCAATCTCCAATCAGG
TTTCAAGAACCAAGATCATTTTTTCCAACCGAGATCGTCACCTTGGTCGAAACAAGGTTCAAGTAA
AA sequence
>Lus10015031 pacid=23152720 polypeptide=Lus10015031 locus=Lus10015031.g ID=Lus10015031.BGIv1.0 annot-version=v1.0
MVGCEDDMLNEVFDDAPPVFYWRLEAGWDYESALSGPTGSTLEALRSEYLFSKSRPQLIFKHSFEREIRPVGAYLCSALVCPMLQEYWSRPVINDQSPIR
FQEPRSFFPTEIVTLVETRFK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10015031 0 1
AT1G49230 RING/U-box superfamily protein... Lus10005817 11.2 0.7291
AT4G28610 GARP ATPHR1, PHR1 phosphate starvation response ... Lus10024938 15.7 0.5947
AT1G43700 bZIP SUE3, AtbZIP51,... sulphate utilization efficienc... Lus10042802 23.7 0.6385
AT4G21330 bHLH bHLH022, DYT1 DYSFUNCTIONAL TAPETUM 1, basic... Lus10007618 27.7 0.6300
AT3G43660 Vacuolar iron transporter (VIT... Lus10042804 31.4 0.5683
AT2G31600 unknown protein Lus10025558 46.7 0.5772
AT5G53590 SAUR-like auxin-responsive pro... Lus10006820 49.1 0.5552
Lus10036643 65.7 0.5530
AT1G01050 ATPPA1 pyrophosphorylase 1 (.1) Lus10005139 73.1 0.5855
AT4G32600 RING/U-box superfamily protein... Lus10013144 116.6 0.4873

Lus10015031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.