Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G07820 76 / 1e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G061701 [exp] 56 / 3e-12 AT2G07820 57 / 2e-12 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015035 pacid=23171493 polypeptide=Lus10015035 locus=Lus10015035.g ID=Lus10015035.BGIv1.0 annot-version=v1.0 ATGGATCCTGCTCTAAGACTCTCGCTTATTCCACAAGAAATATCTCAAGCGGAAGAGGAAAAGCTCGAATGTGAGCAATTGCTTGGTCTGTTCTGGGAGC ATCCGCCTGCTATCAATCCGGAGGCCATAGCACAAGTTATGCAACAGAGTCGGGACCAGATTCGTGGTCTCGATGACCGGAAGAGGGCGCTCCTCAAAAA AGAGCGTCAGCTCATTCTTCAGGGAGCAAGTGGTCACCTGGGAGAATAG
AA sequence Show only first row Show all	>Lus10015035 pacid=23171493 polypeptide=Lus10015035 locus=Lus10015035.g ID=Lus10015035.BGIv1.0 annot-version=v1.0 MDPALRLSLIPQEISQAEEEKLECEQLLGLFWEHPPAINPEAIAQVMQQSRDQIRGLDDRKRALLKKERQLILQGASGHLGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G07820			unknown protein		Lus10015035 [exp]	0	1
					Lus10009498 [exp]	1.0	0.9784
AT2G46520			cellular apoptosis susceptibil...		Lus10005969 [exp]	2.2	0.9674
AT3G12440			Polynucleotidyl transferase, r...		Lus10000103 [exp]	2.8	0.9742
AT1G64790		ILA	ILITYHIA (.1.2)		Lus10003102 [exp]	4.2	0.9728
AT5G24350			unknown protein		Lus10022371 [exp]	5.5	0.9593
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10025169 [exp]	5.7	0.9720
					Lus10004082 [exp]	5.9	0.9636
AT1G16800			P-loop containing nucleoside t...		Lus10037304 [exp]	6.0	0.9674
AT3G10650		AtNUP1	unknown protein		Lus10034137 [exp]	7.1	0.9533
					Lus10021651 [exp]	8.9	0.9520

Compare expression of checked genes

Lus10015035 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.