Plant FIBer expression Database

Lus10015040 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02710 172 / 4e-55 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003988
[exp]
332 / 2e-118 AT5G02710 175 / 3e-56 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G215300
[exp]
208 / 1e-69 AT5G02710 208 / 1e-69 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03692 CxxCxxCC Putative zinc- or iron-chelating domain
Representative CDS sequence
>Lus10015040 pacid=23171534 polypeptide=Lus10015040 locus=Lus10015040.g ID=Lus10015040.BGIv1.0 annot-version=v1.0
ATGTCTCACGCCTTAGCTTTGTCATGTGTTGGTAGCGTCATCCCGGCGACTGACCACCGGCAACTCAACTTTGGTAAAAGCGGTGCAATAAGAATGCAGA
ATCAACAACAGTCTAATCAGAACAAAATCAAGAGAGGAAAAAACGCCCACAAAGTATTCCCCAGTCAGAGGAAGGACTCGACGTGGAAATGCGTGGAGGG
CTGCGGTGCTTGCTGCAAGTTGGATAAGGGTCCACTTTTCCCCACTCCTGAAGAAATCTTCACTGATTCTTCTGATGTCGAGCTGTATAGAAGCTTAATA
GGTCCGGATGGATGGTGCATTCACTACGAGAAAAGCACCCGAAAGTGCTCTATTTACGCCGATCGGCCGTACTTTTGTCGAGTGGATGAAGATGTGTTCG
AGGACTTGTATGGAATCAACAAGAAGATGTTCAATAGAGAGGCTTGCAACTCGTGTAGAGACACGATCGAGATGATCTACGGGTTTGATTCAAAAGAATT
AAACAACTTCAACCAGTCTCTGGAGAAGTGA
AA sequence
>Lus10015040 pacid=23171534 polypeptide=Lus10015040 locus=Lus10015040.g ID=Lus10015040.BGIv1.0 annot-version=v1.0
MSHALALSCVGSVIPATDHRQLNFGKSGAIRMQNQQQSNQNKIKRGKNAHKVFPSQRKDSTWKCVEGCGACCKLDKGPLFPTPEEIFTDSSDVELYRSLI
GPDGWCIHYEKSTRKCSIYADRPYFCRVDEDVFEDLYGINKKMFNREACNSCRDTIEMIYGFDSKELNNFNQSLEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02710 unknown protein Lus10015040
[exp]
0 1
AT4G31650 B3 REM6 Transcriptional factor B3 fami... Lus10026265
[exp]
2.0 0.8477
AT5G02710 unknown protein Lus10003988
[exp]
4.0 0.8565
AT2G32180 PTAC18 plastid transcriptionally acti... Lus10035307
[exp]
6.1 0.8588
AT1G71460 Pentatricopeptide repeat (PPR-... Lus10006174
[exp]
7.6 0.7525
AT5G02130 NDP1 Tetratricopeptide repeat (TPR)... Lus10023783
[exp]
9.2 0.8012
AT5G06600 AtUBP12, UBP12 ubiquitin-specific protease 12... Lus10027030
[exp]
9.5 0.8010
AT2G34960 CAT5 cationic amino acid transporte... Lus10018691
[exp]
9.9 0.7907
AT5G16140 Peptidyl-tRNA hydrolase family... Lus10031901
[exp]
18.4 0.8550
AT3G03580 Tetratricopeptide repeat (TPR)... Lus10004744
[exp]
22.6 0.7225
AT4G37170 Pentatricopeptide repeat (PPR)... Lus10007772
[exp]
22.6 0.7956

Lus10015040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.