Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024480 [exp] 40 / 2e-05 ND / Lus10003489 [exp] 39 / 8e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015043 pacid=23171512 polypeptide=Lus10015043 locus=Lus10015043.g ID=Lus10015043.BGIv1.0 annot-version=v1.0 ATGCCGCCGCCTCCCTCATCGGCAACAAAGAAGAGAACGAAAAGGGTTGGGGAATCGATGGAGAGGGGAGAAGACGATCCCGCCGCCGACGACGTGAAAG GTGGCAGCGGCGAAGCATCAGACAGAGCGAAAGGGAAACATGTAAGGAGAAGAAAAAAGCTGTTTATATCTATCCTTGAAATTTGA
AA sequence Show only first row Show all	>Lus10015043 pacid=23171512 polypeptide=Lus10015043 locus=Lus10015043.g ID=Lus10015043.BGIv1.0 annot-version=v1.0 MPPPPSSATKKRTKRVGESMERGEDDPAADDVKGGSGEASDRAKGKHVRRRKKLFISILEI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015043 [exp]	0	1
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10003459 [exp]	16.9	0.7780
AT1G03890			RmlC-like cupins superfamily p...		Lus10033893 [exp]	20.3	0.7658
AT4G00910			Aluminium activated malate tra...		Lus10033223 [exp]	28.9	0.7892
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10033385 [exp]	30.4	0.7893
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10007853 [exp]	31.1	0.7497
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10018785 [exp]	44.9	0.7424
AT3G58060			Cation efflux family protein (...		Lus10029300 [exp]	54.6	0.7157
AT1G14600	GARP		Homeodomain-like superfamily p...		Lus10029808 [exp]	65.3	0.7114
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10025975 [exp]	71.0	0.7367
					Lus10033100 [exp]	81.2	0.6861

Compare expression of checked genes

Lus10015043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.