Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01310 77 / 9e-18 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 70 / 1e-15 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 62 / 1e-12 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 59 / 1e-11 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 58 / 4e-11 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 55 / 6e-10 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 54 / 2e-09 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 52 / 5e-09 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 52 / 6e-09 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 51 / 1e-08 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003990 [exp] 208 / 5e-68 AT1G01310 140 / 3e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10009068 [exp] 120 / 5e-35 AT3G09590 149 / 1e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10025279 [exp] 119 / 2e-34 AT3G09590 144 / 7e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 73 / 6e-17 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 72 / 1e-16 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 64 / 2e-13 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 62 / 2e-12 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 62 / 2e-12 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 61 / 3e-12 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G082000 [exp] 79 / 9e-19 AT3G09590 137 / 2e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G215600 [exp] 67 / 4e-14 AT3G09590 132 / 1e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 61 / 2e-12 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 60 / 6e-12 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 60 / 1e-11 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 58 / 3e-11 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083000 [exp] 55 / 5e-10 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082800 [exp] 54 / 1e-09 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 52 / 7e-09 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 52 / 7e-09 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015044 pacid=23171504 polypeptide=Lus10015044 locus=Lus10015044.g ID=Lus10015044.BGIv1.0 annot-version=v1.0 ATGACGTCGCCCAGTACTACTCCCTTAATCCTTGTCCTCTTCATTCTCGCCGCATCCGCCTCCTCTCATTCCAAATCAACCGGTAAATCAATTCCACCTC CACCGCCTCCCAGGGATCAATCCTCTGCTGGCGCGGGCATCATCGATCCCAACCACGTGGAATACAACGGAGAAGGACTAGCCTCTCAATTCATGTACGC ACACAACAAGATCAGGGCGATGTACTACCTCCCGGCCTTGAAATGGAACGGGACCCTGGTCCAATTCGACAGACACTACGCCAACAGCAGGATGAAGGAC TGCCTGCTCCAACACTCCAATGACAGGATCTACGGGGAGGACATGTTGTGGAGCAAGTACGGGCACTGGACCCCATCCAACGTCGTCAAGACCTGGGCCG ACGAGATGAAGTTCTAG
AA sequence Show only first row Show all	>Lus10015044 pacid=23171504 polypeptide=Lus10015044 locus=Lus10015044.g ID=Lus10015044.BGIv1.0 annot-version=v1.0 MTSPSTTPLILVLFILAASASSHSKSTGKSIPPPPPPRDQSSAGAGIIDPNHVEYNGEGLASQFMYAHNKIRAMYYLPALKWNGTLVQFDRHYANSRMKD CLLQHSNDRIYGEDMLWSKYGHWTPSNVVKTWADEMKF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01310			CAP (Cysteine-rich secretory p...		Lus10015044 [exp]	0	1
					Lus10027076 [exp]	5.7	0.8036
AT4G27570			UDP-Glycosyltransferase superf...		Lus10013367 [exp]	9.4	0.8002
					Lus10003825 [exp]	12.2	0.7951
AT5G56990			unknown protein		Lus10029528 [exp]	14.1	0.7951
					Lus10038051 [exp]	15.8	0.7951
AT5G01660			unknown protein		Lus10040599 [exp]	17.3	0.7951
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	18.7	0.7951
AT5G39020			Malectin/receptor-like protein...		Lus10008333 [exp]	19.5	0.7950
					Lus10029261 [exp]	20.0	0.7951
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10029635 [exp]	21.2	0.7951

Compare expression of checked genes

Lus10015044 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.