Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02800 81 / 9e-20 CDL1 CDG1-like 1, Protein kinase superfamily protein (.1) AT2G28590 77 / 2e-18 Protein kinase superfamily protein (.1) AT5G13160 76 / 8e-18 PBS1 avrPphB susceptible 1, Protein kinase superfamily protein (.1) AT1G07870 73 / 6e-17 Protein kinase superfamily protein (.1.2) AT5G18610 70 / 8e-16 Protein kinase superfamily protein (.1.2) AT3G20530 69 / 1e-15 Protein kinase superfamily protein (.1) AT4G13190 63 / 2e-13 Protein kinase superfamily protein (.1) AT3G24790 61 / 1e-12 Protein kinase superfamily protein (.1) AT1G61860 58 / 1e-11 Protein kinase superfamily protein (.1) AT3G07070 58 / 1e-11 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003995 [exp] 112 / 2e-33 AT5G02800 294 / 3e-100 CDG1-like 1, Protein kinase superfamily protein (.1) Lus10014019 [exp] 103 / 9e-28 AT5G02800 532 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1) Lus10019897 [exp] 100 / 4e-27 AT5G02800 533 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1) Lus10023473 [exp] 83 / 2e-20 AT5G18610 568 / 0.0 Protein kinase superfamily protein (.1.2) Lus10040350 [exp] 83 / 2e-20 AT5G18610 569 / 0.0 Protein kinase superfamily protein (.1.2) Lus10036499 [exp] 80 / 2e-19 AT5G18610 575 / 0.0 Protein kinase superfamily protein (.1.2) Lus10041426 [exp] 79 / 6e-19 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2) Lus10033966 [exp] 72 / 1e-16 AT5G18610 805 / 0.0 Protein kinase superfamily protein (.1.2) Lus10012814 [exp] 71 / 3e-16 AT5G18610 807 / 0.0 Protein kinase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G215100 [exp] 82 / 2e-20 AT5G18610 595 / 0.0 Protein kinase superfamily protein (.1.2) Potri.008G046500 [exp] 82 / 3e-20 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2) Potri.006G133300 [exp] 80 / 2e-19 AT5G02800 566 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1) Potri.009G026500 [exp] 74 / 2e-17 AT1G07870 595 / 0.0 Protein kinase superfamily protein (.1.2) Potri.001G234100 [exp] 74 / 3e-17 AT1G07870 590 / 0.0 Protein kinase superfamily protein (.1.2) Potri.011G000500 [exp] 72 / 1e-16 AT3G20530 481 / 2e-170 Protein kinase superfamily protein (.1) Potri.010G021500 [exp] 71 / 3e-16 AT5G18610 779 / 0.0 Protein kinase superfamily protein (.1.2) Potri.003G166900 [exp] 70 / 6e-16 AT5G13160 745 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1) Potri.001G060800 [exp] 70 / 6e-16 AT5G13160 714 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1) Potri.001G421400 [exp] 69 / 2e-15 AT3G20530 587 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015050 pacid=23171518 polypeptide=Lus10015050 locus=Lus10015050.g ID=Lus10015050.BGIv1.0 annot-version=v1.0 ATGGCTGATCCGGTGATGGGTGGACGGTTTCCTGCGAGGGCAATGTACCAAGCTTTAGCGGTTGCAGGGATGTGCGTTCAGGAACAGCCTCACATGAGGC CTGCAATGGCTGATGTTGTCACTGCTTTGTCTCACTTAGCTTCACAGAAGAGTGCAACTGAGAAGCAACAGCACGCACAAACCTTGGCTGGTGGATTGGT GGCCTAA
AA sequence Show only first row Show all	>Lus10015050 pacid=23171518 polypeptide=Lus10015050 locus=Lus10015050.g ID=Lus10015050.BGIv1.0 annot-version=v1.0 MADPVMGGRFPARAMYQALAVAGMCVQEQPHMRPAMADVVTALSHLASQKSATEKQQHAQTLAGGLVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02800		CDL1	CDG1-like 1, Protein kinase su...		Lus10015050 [exp]	0	1
AT5G18610			Protein kinase superfamily pro...		Lus10015051 [exp]	1.0	0.7691
AT4G03080		BSL1	BRI1 suppressor 1 (BSU1)-like ...		Lus10024771 [exp]	4.0	0.6593
AT5G02800		CDL1	CDG1-like 1, Protein kinase su...		Lus10003995 [exp]	6.0	0.6546
AT2G42010		PLDBETA1	phospholipase D beta 1 (.1)		Lus10026378 [exp]	6.8	0.6945
AT4G28703			RmlC-like cupins superfamily p...		Lus10025947 [exp]	12.0	0.6427
AT5G03795			Exostosin family protein (.1)		Lus10039142 [exp]	12.5	0.6729
AT5G40380		CRK42	cysteine-rich RLK (RECEPTOR-li...		Lus10008764 [exp]	13.4	0.6495
AT4G28950		ATRAC7, ARAC7, ...	Arabidopsis RAC-like 7, RHO-re...		Lus10026189 [exp]	18.0	0.6797
AT1G69550			disease resistance protein (TI...		Lus10018308 [exp]	21.8	0.6723
AT4G33490			Eukaryotic aspartyl protease f...		Lus10033503 [exp]	23.8	0.6772

Compare expression of checked genes

Lus10015050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.