Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35795 118 / 3e-36 Chaperone DnaJ-domain superfamily protein (.1) AT5G03030 117 / 1e-35 Chaperone DnaJ-domain superfamily protein (.1) AT3G09700 115 / 5e-35 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019915 [exp] 147 / 3e-43 AT5G28540 321 / 2e-101 heat shock protein 70 (Hsp 70) family protein (.1) Lus10026485 [exp] 124 / 5e-37 AT1G09080 124 / 2e-36 binding protein 3, Heat shock protein 70 (Hsp 70) family protein (.1), Heat shock protein 70 (Hsp 70) family protein (.2) Lus10041420 [exp] 113 / 1e-33 AT2G35795 194 / 2e-65 Chaperone DnaJ-domain superfamily protein (.1) Lus10040376 [exp] 108 / 2e-29 AT5G03030 184 / 6e-58 Chaperone DnaJ-domain superfamily protein (.1) Lus10023494 [exp] 98 / 1e-28 AT5G03030 135 / 3e-43 Chaperone DnaJ-domain superfamily protein (.1) Lus10036507 [exp] 86 / 3e-23 AT2G35795 163 / 3e-53 Chaperone DnaJ-domain superfamily protein (.1) Lus10022246 [exp] 38 / 0.0003 AT5G23240 139 / 2e-37 DNAJ heat shock N-terminal domain-containing protein (.1) Lus10008768 [exp] 37 / 0.0006 AT5G23240 141 / 6e-39 DNAJ heat shock N-terminal domain-containing protein (.1) Lus10002733 [exp] 37 / 0.001 AT5G22060 299 / 6e-100 ARABIDOPSIS THALIANA DNAJ HOMOLOGUE 2, DNAJ homologue 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G131200 [exp] 115 / 3e-35 AT2G35795 195 / 2e-66 Chaperone DnaJ-domain superfamily protein (.1) Potri.008G043500 [exp] 112 / 8e-34 AT2G35795 179 / 4e-60 Chaperone DnaJ-domain superfamily protein (.1) Potri.012G038800 [exp] 103 / 2e-30 AT2G35795 160 / 3e-52 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G347600 [exp] 39 / 0.0001 AT5G23240 149 / 2e-41 DNAJ heat shock N-terminal domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10015065 pacid=23171503 polypeptide=Lus10015065 locus=Lus10015065.g ID=Lus10015065.BGIv1.0 annot-version=v1.0 ATGATCCGAGCATGGCACACTTTGAAGACGAGGCCGCGCTCATTCTACCAAGGCGGGTTTCAATCTAGCATGACAAAGAGAGAAGCAGCGCTTATACTTG GAGTAAGGGAAAGAACGTCAGCTAAAGATGTGAAGGATGCATATAAGAATGTGATGAAAGCAAACCATCCGGACCAAGGAGGTAGCCACTACCTGTCAAA CAAGATAAATGAAGCAAAGAACGTCATGCTGGGTGGCCAGAATTCGAGCTCTGCTTTTTAA
AA sequence Show only first row Show all	>Lus10015065 pacid=23171503 polypeptide=Lus10015065 locus=Lus10015065.g ID=Lus10015065.BGIv1.0 annot-version=v1.0 MIRAWHTLKTRPRSFYQGGFQSSMTKREAALILGVRERTSAKDVKDAYKNVMKANHPDQGGSHYLSNKINEAKNVMLGGQNSSSAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35795			Chaperone DnaJ-domain superfam...		Lus10015065 [exp]	0	1
AT2G42770			Peroxisomal membrane 22 kDa (M...		Lus10001421 [exp]	4.9	0.7638
					Lus10030127 [exp]	7.9	0.7224
AT1G15215		SHH1, DTF1	SAWADEE homeodomain homolog 1,...		Lus10038276 [exp]	8.7	0.7378
AT5G11340			Acyl-CoA N-acyltransferases (N...		Lus10013120 [exp]	14.0	0.7439
AT5G55530			Calcium-dependent lipid-bindin...		Lus10043169 [exp]	18.3	0.7398
AT1G19600			pfkB-like carbohydrate kinase ...		Lus10007397 [exp]	21.3	0.7406
AT3G08890			Protein of unknown function, D...		Lus10022674 [exp]	31.9	0.7288
AT5G11600			unknown protein		Lus10001603 [exp]	36.2	0.7199
AT1G53120			RNA-binding S4 domain-containi...		Lus10005545 [exp]	36.5	0.6993
AT3G27100			unknown protein		Lus10012534 [exp]	40.8	0.7202

Compare expression of checked genes

Lus10015065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.