Lus10015073 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G37120 46 / 4e-08 S1FA-like DNA-binding protein (.1)
AT3G09735 41 / 3e-06 S1FA-like DNA-binding protein (.1)
AT3G53370 36 / 0.0003 S1FA-like DNA-binding protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023177 126 / 2e-39 AT2G37120 68 / 1e-16 S1FA-like DNA-binding protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G087400 84 / 6e-23 AT3G09735 41 / 3e-06 S1FA-like DNA-binding protein (.1)
Potri.006G130200 81 / 1e-21 AT3G09735 / S1FA-like DNA-binding protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04689 S1FA DNA binding protein S1FA
Representative CDS sequence
>Lus10015073 pacid=23171497 polypeptide=Lus10015073 locus=Lus10015073.g ID=Lus10015073.BGIv1.0 annot-version=v1.0
ATGTCCGACGATTCCGAGTTCGCCGATCAGTCCACTCCCTCATTTGAGCGCATGGGAAAGGCGATGAAGGACGCGGAGGCTAAAGGGTTCAACCCAGGAC
TGATAGTGTTGCTGGTTATAGGAACCCTGGTTCTGGCATTCCTGATCGGGAATTATGCGTTGTACATGTATGCTCAGAAGACTCTTCCTGCTAGGAAGAA
GAAGCCAGTGTCCAAGAAGAAGATGAAGAGGGAAAGACTGAAGCAAGGCGTGTCTGCACCTGGAGAGTGA
AA sequence
>Lus10015073 pacid=23171497 polypeptide=Lus10015073 locus=Lus10015073.g ID=Lus10015073.BGIv1.0 annot-version=v1.0
MSDDSEFADQSTPSFERMGKAMKDAEAKGFNPGLIVLLVIGTLVLAFLIGNYALYMYAQKTLPARKKKPVSKKKMKRERLKQGVSAPGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G37120 S1FA-like DNA-binding protein ... Lus10015073 0 1
AT3G15395 unknown protein Lus10039067 1.0 0.8313
AT1G73177 APC13, BNS anaphase-promoting complex 13,... Lus10029234 1.4 0.8012
AT2G26110 Protein of unknown function (D... Lus10026978 7.5 0.7084
AT2G30410 TFCA, KIS TUBULIN FOLDING FACTOR A, tubu... Lus10031323 7.9 0.7462
AT5G61310 Cytochrome c oxidase subunit V... Lus10040012 8.1 0.7390
AT4G38370 Phosphoglycerate mutase family... Lus10023935 8.8 0.7520
AT2G37120 S1FA-like DNA-binding protein ... Lus10023177 9.2 0.7906
AT1G32210 ATDAD1 DEFENDER AGAINST APOPTOTIC DEA... Lus10010413 12.0 0.7663
AT5G11340 Acyl-CoA N-acyltransferases (N... Lus10008088 13.0 0.7417
AT1G11755 LEW1 LEAF WILTING 1, Undecaprenyl p... Lus10042338 13.2 0.7562

Lus10015073 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.