Lus10015075 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09740 347 / 2e-121 ATSYP71, SYP71 syntaxin of plants 71 (.1)
AT3G45280 281 / 3e-95 ATSYP72, SYP72 syntaxin of plants 72 (.1)
AT3G61450 280 / 5e-95 ATSYP73, SYP73 syntaxin of plants 73 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023178 450 / 6e-162 AT3G09740 416 / 1e-148 syntaxin of plants 71 (.1)
Lus10019925 402 / 5e-143 AT3G09740 419 / 2e-149 syntaxin of plants 71 (.1)
Lus10026495 392 / 9e-139 AT3G09740 408 / 5e-145 syntaxin of plants 71 (.1)
Lus10036118 301 / 4e-103 AT3G45280 363 / 3e-127 syntaxin of plants 72 (.1)
Lus10036377 297 / 1e-97 AT3G09740 347 / 8e-117 syntaxin of plants 71 (.1)
Lus10014759 293 / 6e-96 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1)
Lus10007411 59 / 4e-11 AT3G09740 65 / 1e-13 syntaxin of plants 71 (.1)
Lus10037092 42 / 0.0003 AT1G13890 327 / 1e-113 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10016577 42 / 0.0003 AT1G79590 319 / 1e-111 syntaxin of plants 52 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G129500 358 / 6e-126 AT3G09740 377 / 3e-133 syntaxin of plants 71 (.1)
Potri.016G088200 355 / 2e-124 AT3G09740 384 / 3e-136 syntaxin of plants 71 (.1)
Potri.014G087400 303 / 5e-104 AT3G09740 352 / 2e-123 syntaxin of plants 71 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
Representative CDS sequence
>Lus10015075 pacid=23171533 polypeptide=Lus10015075 locus=Lus10015075.g ID=Lus10015075.BGIv1.0 annot-version=v1.0
ATGAGCGTGATCGACCTTCTCACAAGAGTCGACTCAATCTGCCAGAAGTACGAGAGATACGACGTCGATAAGCAGAAGAATCTCAATGTCTCCGGCGACG
ACGCCTTCGCTCGCGGATACGCTGCAGTTGACGCCGAAATCGAAGCTGCTCTTGAGAAAGCAGAACTTGCAGCCAGTGAGAAGAGTAAGGCGTCCACTGT
AGCTCTCAATGCCGAGCTTCGTCGAACCAAGGCAAGACTGCTAGAAGAAGTTCCAAAGTTGCAGAGGCTCGCGGTAAAGAAGGTAAAAGGCCTTTCTACA
GAAGAGCTTACTGCCCGTAATGACTTGGTTCTTGCATTACCCGACAGAATCCAAGCTATTCCCGATGGAAATACAGCTGCACTGAAACAAACTGGAGGCT
GGGGGCCTTCAGCTTCCCGCACAGAAATCAAGTTTGATTCAGATGGCCGTTTAGATGATGAATATTTTCAAGAATCTGAGGAGTCAAGTCAGTTTAGGCA
GGAGTATGAAACACGTAAAAAGAAGCAGGATCATGGTCTGGAGATGATCTCAGAAGGTTTGGATACTTTGAAGAACATGGCTCATGACATGAATGAGGAA
ATGGACAGGCAAGCTCCTCTGGCGGATGAAATTGATGCCAAGGTGGATAAGGCAGCTTCTGATCTTAAGAACACTAATGTTAGACTGAAGGACACTGTTA
CACAGTTACGATCCAGCAGAAACTTCTGCATCGATATTGTTTTGTTGTGCGTGATATTGGGCATTGCTGCTTATCTGTTCAATGCGCTGAAGAACTGA
AA sequence
>Lus10015075 pacid=23171533 polypeptide=Lus10015075 locus=Lus10015075.g ID=Lus10015075.BGIv1.0 annot-version=v1.0
MSVIDLLTRVDSICQKYERYDVDKQKNLNVSGDDAFARGYAAVDAEIEAALEKAELAASEKSKASTVALNAELRRTKARLLEEVPKLQRLAVKKVKGLST
EELTARNDLVLALPDRIQAIPDGNTAALKQTGGWGPSASRTEIKFDSDGRLDDEYFQESEESSQFRQEYETRKKKQDHGLEMISEGLDTLKNMAHDMNEE
MDRQAPLADEIDAKVDKAASDLKNTNVRLKDTVTQLRSSRNFCIDIVLLCVILGIAAYLFNALKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10015075 0 1
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10023178 3.2 0.8831
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10023242 3.7 0.9039
AT4G02600 MLO1, ATMLO1 MILDEW RESISTANCE LOCUS O 1, S... Lus10027093 6.3 0.8920
AT5G57330 Galactose mutarotase-like supe... Lus10015540 7.7 0.8913
AT4G33740 unknown protein Lus10020507 7.7 0.9116
AT3G12760 unknown protein Lus10000875 10.4 0.8780
AT5G57330 Galactose mutarotase-like supe... Lus10020015 13.7 0.8800
AT4G21790 ATTOM1, TOM1 tobamovirus multiplication 1 (... Lus10007663 14.1 0.8944
AT5G38660 APE1 acclimation of photosynthesis ... Lus10034073 16.1 0.8764
AT5G42190 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubi... Lus10005610 17.9 0.8875

Lus10015075 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.