Lus10015077 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65980 268 / 3e-93 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT1G65970 259 / 4e-90 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G60740 257 / 3e-89 Thioredoxin superfamily protein (.1)
AT1G65990 188 / 1e-57 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
AT3G52960 175 / 8e-56 Thioredoxin superfamily protein (.1)
AT3G06050 107 / 2e-29 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023180 328 / 2e-117 AT1G65980 268 / 2e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10023662 312 / 7e-111 AT1G65980 264 / 5e-92 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10002843 176 / 5e-56 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10003373 175 / 7e-56 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10021932 107 / 4e-29 AT3G06050 317 / 6e-111 peroxiredoxin IIF (.1)
Lus10041218 93 / 1e-22 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G423500 283 / 1e-99 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.018G083500 280 / 4e-98 AT1G65980 280 / 4e-98 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.013G102100 174 / 2e-55 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.019G024000 100 / 1e-26 AT3G06050 311 / 2e-109 peroxiredoxin IIF (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Lus10015077 pacid=23171510 polypeptide=Lus10015077 locus=Lus10015077.g ID=Lus10015077.BGIv1.0 annot-version=v1.0
ATGGCTCCGATAGCTGCCGGTGCTTCCTTGCCTGACGGAACTCTCGCTCACTTCGACGAGAACGATCAGCTCCAGCAGGTCTCCATCCACTCCCTCGCCG
CTGGCAAGAAGGTTGTCATCGTCGGTGTTCCCGGCGCCTTCACTCCAACTTGCAGCTTGAAGCATGTACCTGGATTCATCGAGAGAGCGGATGACCTCAA
AGCCAAAGGTGTTGCAGAGATAATCACTATTAGCGTGAATGATCCATTTGTGATGAAAGCTTGGGCAAAGACCTTCCCAGAGAACAAGCACGTGAAGTTC
TTGGCAGATGGCTCTGCAACTTACACCCATGCTCTGGGTGTTGAGCTTGACCTAAAGGAGAAGGGACTAGGGATCAGATCAAGGAGGTTTGCTCTACTGG
TCGATGACCTCAAGGTGAAGGCTGCAAACATTGAAGATGGTGGAGACTTCACAGTTTCGAGTGTTGATGATATCATCAAGGCCCTTGATGCTTGA
AA sequence
>Lus10015077 pacid=23171510 polypeptide=Lus10015077 locus=Lus10015077.g ID=Lus10015077.BGIv1.0 annot-version=v1.0
MAPIAAGASLPDGTLAHFDENDQLQQVSIHSLAAGKKVVIVGVPGAFTPTCSLKHVPGFIERADDLKAKGVAEIITISVNDPFVMKAWAKTFPENKHVKF
LADGSATYTHALGVELDLKEKGLGIRSRRFALLVDDLKVKAANIEDGGDFTVSSVDDIIKALDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65980 TPX1 thioredoxin-dependent peroxida... Lus10015077 0 1
AT1G69330 RING/U-box superfamily protein... Lus10004666 3.5 0.8393
AT1G58210 EMB1674 EMBRYO DEFECTIVE 1674, kinase ... Lus10001866 4.9 0.8503
AT2G05320 beta-1,2-N-acetylglucosaminylt... Lus10001174 6.3 0.8344
AT4G14010 RALFL32 ralf-like 32 (.1) Lus10023223 7.1 0.8263
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Lus10034554 8.6 0.8600
AT4G16450 unknown protein Lus10038803 9.7 0.8130
AT1G67740 YCF32, PSBY photosystem II BY (.1) Lus10006243 15.7 0.8424
AT2G40860 protein kinase family protein ... Lus10002993 19.1 0.8044
AT1G47056 VFB1 VIER F-box proteine 1 (.1) Lus10018737 21.6 0.8203
AT4G24930 thylakoid lumenal 17.9 kDa pro... Lus10007492 22.4 0.8337

Lus10015077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.