Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01650 51 / 5e-09 RGLG1 RING domain ligase1 (.1) AT1G67800 50 / 2e-08 Copine (Calcium-dependent phospholipid-binding protein) family AT5G14420 46 / 4e-07 RGLG2 RING domain ligase2 (.1.2.3.4) AT5G63970 41 / 2e-05 Copine (Calcium-dependent phospholipid-binding protein) family (.1), Copine (Calcium-dependent phospholipid-binding protein) family (.2) AT1G79380 40 / 4e-05 Ca(2)-dependent phospholipid-binding protein (Copine) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022294 [exp] 56 / 1e-10 AT3G01650 608 / 0.0 RING domain ligase1 (.1) Lus10014587 [exp] 56 / 1e-10 AT3G01650 517 / 0.0 RING domain ligase1 (.1) Lus10032097 [exp] 56 / 2e-10 AT3G01650 514 / 0.0 RING domain ligase1 (.1) Lus10033043 [exp] 50 / 1e-08 AT3G01650 492 / 4e-172 RING domain ligase1 (.1) Lus10017775 [exp] 49 / 4e-08 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10036879 [exp] 48 / 6e-08 AT3G01650 555 / 0.0 RING domain ligase1 (.1) Lus10006231 [exp] 48 / 1e-07 AT3G01650 514 / 0.0 RING domain ligase1 (.1) Lus10000144 [exp] 47 / 1e-07 AT5G14420 384 / 2e-132 RING domain ligase2 (.1.2.3.4) Lus10006463 [exp] 46 / 3e-07 AT3G01650 547 / 0.0 RING domain ligase1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G086200 [exp] 51 / 4e-09 AT5G14420 313 / 2e-105 RING domain ligase2 (.1.2.3.4) Potri.001G342200 [exp] 51 / 5e-09 AT5G14420 572 / 0.0 RING domain ligase2 (.1.2.3.4) Potri.012G090100 [exp] 49 / 2e-08 AT5G14420 575 / 0.0 RING domain ligase2 (.1.2.3.4) Potri.008G183600 [exp] 49 / 4e-08 AT5G14420 571 / 0.0 RING domain ligase2 (.1.2.3.4) Potri.016G003000 [exp] 46 / 2e-07 AT5G14420 500 / 2e-176 RING domain ligase2 (.1.2.3.4) Potri.010G049600 [exp] 45 / 4e-07 AT5G14420 580 / 0.0 RING domain ligase2 (.1.2.3.4) Potri.006G002600 [exp] 44 / 1e-06 AT5G14420 521 / 0.0 RING domain ligase2 (.1.2.3.4) Potri.010G174800 [exp] 39 / 8e-05 AT1G79380 535 / 0.0 Ca(2)-dependent phospholipid-binding protein (Copine) family (.1) Potri.005G065700 [exp] 39 / 0.0001 AT5G63970 551 / 0.0 Copine (Calcium-dependent phospholipid-binding protein) family (.1), Copine (Calcium-dependent phospholipid-binding protein) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015079 pacid=23171514 polypeptide=Lus10015079 locus=Lus10015079.g ID=Lus10015079.BGIv1.0 annot-version=v1.0 ATGTCGAAGAATGTGGATGAATCCCACAAGGAGCTACAAATTGGGCTTTCTGCTCTGATGGAAATGCCGACTCAGTACAAGGCAACAATGGAGCTTAATG GATTTCAGATGCAAATGGAAGTTGCTGATAGTATTGGTGAGGCAGACCTACTTCTTCTTGATAGCCTTGGTGAAGCTCCCACAGGAACAATAGGCACCAG CTTTTTAAAGGATTTAAGTGACGAAGACAGGTCGAAATGA
AA sequence Show only first row Show all	>Lus10015079 pacid=23171514 polypeptide=Lus10015079 locus=Lus10015079.g ID=Lus10015079.BGIv1.0 annot-version=v1.0 MSKNVDESHKELQIGLSALMEMPTQYKATMELNGFQMQMEVADSIGEADLLLLDSLGEAPTGTIGTSFLKDLSDEDRSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01650		RGLG1	RING domain ligase1 (.1)		Lus10015079 [exp]	0	1
AT3G19620			Glycosyl hydrolase family prot...		Lus10002128 [exp]	1.4	0.9963
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10027584 [exp]	1.7	0.9617
					Lus10036535 [exp]	2.0	0.9871
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10001543 [exp]	6.5	0.9195
AT1G02050		LAP6	LESS ADHESIVE POLLEN 6, Chalco...		Lus10039904 [exp]	7.5	0.9179
AT2G47485			unknown protein		Lus10036328 [exp]	8.0	0.9008
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10003792 [exp]	14.7	0.9131
AT3G28910	MYB	AtMYB30, MYB30	myb domain protein 30 (.1)		Lus10015369 [exp]	15.0	0.9016
					Lus10013528 [exp]	30.0	0.9315
					Lus10036646 [exp]	33.8	0.9275

Compare expression of checked genes

Lus10015079 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.