Lus10015082 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27830 44 / 6e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020544 87 / 8e-22 AT2G27830 181 / 3e-58 unknown protein
Lus10009391 86 / 2e-20 AT2G27830 130 / 7e-36 unknown protein
Lus10033121 45 / 4e-06 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G188600 49 / 1e-07 AT2G27830 160 / 5e-50 unknown protein
Potri.009G149200 42 / 5e-05 AT2G27830 183 / 6e-59 unknown protein
PFAM info
Representative CDS sequence
>Lus10015082 pacid=23171508 polypeptide=Lus10015082 locus=Lus10015082.g ID=Lus10015082.BGIv1.0 annot-version=v1.0
ATGCCCTACATGCGACGGAACTTGGCGGTGGGATCGATCTTCGCTGCTTCCGATATCAGGCCGTTGAAGCTGACGAAGCTCCTCCTCAACGTTACCGTCC
AAAGAAGGGTCGGCGCCGTACGAGTTCTTGCGGCACCAGAATCTAGTGTCGGAGATCTAATCTTGATCGTCGTCCGTCAATACAGCAAGGATGGGCGCCG
GCCTCTACTCACTAAAGAAGCTATTGAATGGCTTGCTAGTCATGTTGGTATGCCACTGACTAAATTTGTTCGAGATGTGCTAGATGTGAAAGTACGTGTC
CTTCGGGATCCTGAAGTTCTACCTGTTGCTAAGATTCTTCTTGATGTTGGAGGTTGTAAGTGTACGATCCAGGTTGAATATCCTCAAGCAAGGCAATACA
AGAAAACTGGTGAATCTAAACGAAAGTGGGTGATGAAGGAGACGATTATTAACAAAGACGATTATTAA
AA sequence
>Lus10015082 pacid=23171508 polypeptide=Lus10015082 locus=Lus10015082.g ID=Lus10015082.BGIv1.0 annot-version=v1.0
MPYMRRNLAVGSIFAASDIRPLKLTKLLLNVTVQRRVGAVRVLAAPESSVGDLILIVVRQYSKDGRRPLLTKEAIEWLASHVGMPLTKFVRDVLDVKVRV
LRDPEVLPVAKILLDVGGCKCTIQVEYPQARQYKKTGESKRKWVMKETIINKDDY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27830 unknown protein Lus10015082 0 1
AT5G58510 unknown protein Lus10031851 6.6 0.7088
AT1G21750 ATPDI5, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Lus10015305 16.5 0.6951
AT2G41560 ACA4 "autoinhibited Ca\(2+\)-ATPase... Lus10031053 19.0 0.7074
AT1G68050 ADO3, FKF1 "flavin-binding, kelch repeat,... Lus10013237 19.6 0.7015
AT5G24310 ABIL3 ABL interactor-like protein 3 ... Lus10023052 26.1 0.6503
AT1G71240 Plant protein of unknown funct... Lus10027905 30.7 0.7042
AT4G25640 FFT, ATDTX35 FLOWER FLAVONOID TRANSPORTER, ... Lus10027504 34.5 0.6602
AT2G34930 disease resistance family prot... Lus10002743 35.9 0.6510
AT4G02250 Plant invertase/pectin methyle... Lus10008201 36.1 0.6453
Lus10022149 44.0 0.6669

Lus10015082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.