Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60670 95 / 4e-27 Ribosomal protein L11 family protein (.1) AT2G37190 91 / 2e-25 Ribosomal protein L11 family protein (.1) AT3G53430 90 / 6e-25 Ribosomal protein L11 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023186 [exp] 102 / 5e-30 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10026506 [exp] 102 / 5e-30 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10019935 [exp] 102 / 5e-30 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10041308 [exp] 97 / 9e-28 AT5G60670 305 / 6e-108 Ribosomal protein L11 family protein (.1) Lus10037402 [exp] 92 / 9e-26 AT5G60670 300 / 4e-106 Ribosomal protein L11 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G145506 [exp] 87 / 1e-23 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G145504 [exp] 87 / 1e-23 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G146600 [exp] 87 / 1e-23 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G145200 [exp] 87 / 1e-23 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.006G077200 [exp] 84 / 7e-23 AT2G37190 295 / 7e-104 Ribosomal protein L11 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00298 [flax] [poplar] Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Representative CDS sequence Show only first row Show all	>Lus10015085 pacid=23171517 polypeptide=Lus10015085 locus=Lus10015085.g ID=Lus10015085.BGIv1.0 annot-version=v1.0 ATGAAGCCTCGATCGATGGCCAAGGAGTTGAGCGGGACCGTCAAGGAGATCTTGGGCACTTGCGTCTCTGTTGGGTGTACTGTTGACGGCAAGGACCCCA AGGACCTCCAGGAAGAGATTAACGACGGTGATGTTGAGATTCCCTCTGAGTAA
AA sequence Show only first row Show all	>Lus10015085 pacid=23171517 polypeptide=Lus10015085 locus=Lus10015085.g ID=Lus10015085.BGIv1.0 annot-version=v1.0 MKPRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQEEINDGDVEIPSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60670			Ribosomal protein L11 family p...		Lus10015085 [exp]	0	1
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10021027 [exp]	1.0	0.9066
AT2G42710			Ribosomal protein L1p/L10e fam...		Lus10015809 [exp]	5.7	0.8196
AT3G26618		ERF1-3	eukaryotic release factor 1-3 ...		Lus10032447 [exp]	8.4	0.8213
AT1G66345			Pentatricopeptide repeat (PPR)...		Lus10004045 [exp]	9.1	0.7675
AT2G27710			60S acidic ribosomal protein f...		Lus10006270 [exp]	10.9	0.8559
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Lus10031764 [exp]	11.7	0.8423
AT1G07210			Ribosomal protein S18 (.1)		Lus10038756 [exp]	12.0	0.8307
AT1G53645			hydroxyproline-rich glycoprote...		Lus10013717 [exp]	12.9	0.7372
AT5G60670			Ribosomal protein L11 family p...		Lus10026506 [exp]	13.1	0.8336
AT1G03510			Tetratricopeptide repeat (TPR)...		Lus10018543 [exp]	13.4	0.7326

Compare expression of checked genes

Lus10015085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.