Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60670 134 / 8e-42 Ribosomal protein L11 family protein (.1) AT3G53430 134 / 8e-42 Ribosomal protein L11 family protein (.1) AT2G37190 134 / 8e-42 Ribosomal protein L11 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023186 [exp] 142 / 8e-45 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10026506 [exp] 142 / 8e-45 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10019935 [exp] 142 / 8e-45 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10037402 [exp] 139 / 8e-44 AT5G60670 300 / 4e-106 Ribosomal protein L11 family protein (.1) Lus10041308 [exp] 139 / 1e-43 AT5G60670 305 / 6e-108 Ribosomal protein L11 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G077200 [exp] 141 / 1e-44 AT2G37190 295 / 7e-104 Ribosomal protein L11 family protein (.1) Potri.018G145506 [exp] 140 / 3e-44 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G145504 [exp] 140 / 3e-44 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G146600 [exp] 140 / 3e-44 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G145200 [exp] 140 / 3e-44 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03946 [flax] [poplar] Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10015086 pacid=23171520 polypeptide=Lus10015086 locus=Lus10015086.g ID=Lus10015086.BGIv1.0 annot-version=v1.0 ATGCCGCCCAAGTTCGATCCGTCGCAGGTCGTCGATGTCTTCGTCCGAGTGACCGGTGGAGAGGTGGGAGCAGCGTCCTCTCTCGCCCCCAAGATCGGTC CATTGGGTCTCTCCCCGAAGAAGATCGGTGAGGACATCGCAAAGGAGACCAGCAAGGACTGGAAGGGACTCCGCGTCACCGTCAAGCTCACCGTCCAGAA CCGTCAGGCCACGCCAGGGGCACGGTGGTCCCTTCCGCTGCTGCTCTTGTCATCAAGGCCCTGA
AA sequence Show only first row Show all	>Lus10015086 pacid=23171520 polypeptide=Lus10015086 locus=Lus10015086.g ID=Lus10015086.BGIv1.0 annot-version=v1.0 MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVTVKLTVQNRQATPGARWSLPLLLLSSRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53430			Ribosomal protein L11 family p...		Lus10015086 [exp]	0	1
AT4G15000			Ribosomal L27e protein family ...		Lus10039017 [exp]	2.4	0.8907
AT3G13882			Ribosomal protein L34 (.1.2)		Lus10015609 [exp]	2.8	0.8881
AT3G10610			Ribosomal S17 family protein (...		Lus10016985 [exp]	7.7	0.8870
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	7.7	0.8720
AT3G03920			H/ACA ribonucleoprotein comple...		Lus10020289 [exp]	13.3	0.8621
AT1G20580			Small nuclear ribonucleoprotei...		Lus10012263 [exp]	14.5	0.8445
AT3G16080			Zinc-binding ribosomal protein...		Lus10011446 [exp]	15.4	0.8628
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10020801 [exp]	27.3	0.8738
AT3G03590			SWIB/MDM2 domain superfamily p...		Lus10005667 [exp]	28.8	0.8498
AT1G09590			Translation protein SH3-like f...		Lus10021079 [exp]	35.9	0.8204

Compare expression of checked genes

Lus10015086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.