Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23160 148 / 6e-42 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23140 142 / 7e-40 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT1G11410 135 / 2e-37 S-locus lectin protein kinase family protein (.1) AT4G23180 133 / 6e-37 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23230 129 / 1e-35 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT4G11470 129 / 3e-35 CRK31 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1) AT4G00970 128 / 4e-35 CRK41 cysteine-rich RLK (RECEPTOR-like protein kinase) 41 (.1) AT4G11480 128 / 5e-35 CRK32 cysteine-rich RLK (RECEPTOR-like protein kinase) 32 (.1) AT4G00960 124 / 1e-34 Protein kinase superfamily protein (.1) AT4G21410 126 / 2e-34 CRK29 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031579 [exp] 268 / 2e-87 AT4G23160 477 / 8e-154 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10031581 [exp] 220 / 1e-69 AT4G23310 213 / 2e-60 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10015091 [exp] 218 / 3e-66 AT5G54650 556 / 1e-178 FORMIN HOMOLOGY 5, formin homology5 (.1.2) Lus10015095 [exp] 209 / 3e-65 AT4G23310 220 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10031577 [exp] 196 / 9e-63 AT4G23160 131 / 2e-33 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10018378 [exp] 131 / 1e-39 AT4G23180 180 / 1e-53 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10009583 [exp] 130 / 3e-39 AT4G23310 164 / 2e-47 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10018381 [exp] 129 / 1e-37 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007633 [exp] 134 / 7e-37 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G120900 [exp] 167 / 5e-49 AT4G23180 454 / 3e-151 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G026350 [exp] 151 / 2e-43 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G024632 [exp] 146 / 3e-43 AT4G23180 527 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G028400 [exp] 147 / 9e-42 AT4G05200 709 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G024800 [exp] 146 / 1e-41 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024404 [exp] 146 / 1e-41 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025100 [exp] 134 / 7e-41 AT4G23180 205 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025800 [exp] 143 / 2e-40 AT4G23180 648 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024500 [exp] 142 / 3e-40 AT4G23180 675 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G028600 [exp] 140 / 2e-39 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10015093 pacid=23149538 polypeptide=Lus10015093 locus=Lus10015093.g ID=Lus10015093.BGIv1.0 annot-version=v1.0 ATGGCACCGGAGTATGCTAGACATGGCCAATTTTCAATCAAATCCGGCGTCTACAGCTTTGGTATCCTTGTTCTGGAACTAGTAACAGGCCGTAGGAACA AGATCCGGAACTCCATTAGTCTTCAAAGTCATGTATGGGATCATTGGAGCAAAGGGGTGGCTCTACAGTCGAGCGATCCGGCCATGGAAAACCGATATGC AAACGTGGAGGTGTTGAAGTGCATACACATCGGGTTGCTTTGCGTTCAAGATTCTTTTGCTGATAGACCAACGATGTCGGAAGTCGTTATGATGCTCAGC AACCATACTGTAACGTATCCAACACCTTCACAGCCTGCTTTTTTCTTAGACAGAGGAAAGAGTTTCGAAGCAGACTACGATAACAACGAAGAAGCTATTC ACTCCAAATCAGAACCGTTGCAGCTGTCTATATCCATCACGGATTTATACCCGATTTGA
AA sequence Show only first row Show all	>Lus10015093 pacid=23149538 polypeptide=Lus10015093 locus=Lus10015093.g ID=Lus10015093.BGIv1.0 annot-version=v1.0 MAPEYARHGQFSIKSGVYSFGILVLELVTGRRNKIRNSISLQSHVWDHWSKGVALQSSDPAMENRYANVEVLKCIHIGLLCVQDSFADRPTMSEVVMMLS NHTVTYPTPSQPAFFLDRGKSFEADYDNNEEAIHSKSEPLQLSISITDLYPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Lus10015093 [exp]	0	1
					Lus10010526 [exp]	1.0	0.9750
AT3G12160		AtRABA4d	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10012032 [exp]	4.9	0.9405
AT1G61330			FBD, F-box and Leucine Rich Re...		Lus10018433 [exp]	6.7	0.8600
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10015095 [exp]	7.2	0.6584
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036868 [exp]	8.7	0.8479
AT1G51990			O-methyltransferase family pro...		Lus10005268 [exp]	8.9	0.8026
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036381 [exp]	10.0	0.8474
					Lus10005843 [exp]	11.0	0.8474
					Lus10022511 [exp]	11.8	0.8474
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10024231 [exp]	12.6	0.8474

Compare expression of checked genes

Lus10015093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.