Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15248 94 / 5e-26 CO B-box type zinc finger family protein (.1) AT3G21890 94 / 8e-26 CO B-box type zinc finger family protein (.1) AT4G27310 77 / 3e-18 CO B-box type zinc finger family protein (.1) AT5G54470 75 / 1e-17 CO B-box type zinc finger family protein (.1) AT3G21150 64 / 2e-13 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) AT1G73870 57 / 2e-10 CO COL7 B-box type zinc finger protein with CCT domain (.1) AT1G25440 56 / 5e-10 CO COL16 B-box type zinc finger protein with CCT domain (.1) AT1G68520 55 / 8e-10 CO COL6 B-box type zinc finger protein with CCT domain (.1) AT2G33500 55 / 9e-10 CO COL14 B-box type zinc finger protein with CCT domain (.1.2) AT2G24790 54 / 1e-09 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031583 [exp] 225 / 9e-78 AT3G21890 96 / 1e-26 B-box type zinc finger family protein (.1) Lus10039694 [exp] 135 / 3e-42 AT4G15248 108 / 1e-31 B-box type zinc finger family protein (.1) Lus10027151 [exp] 131 / 2e-40 AT4G15248 109 / 7e-32 B-box type zinc finger family protein (.1) Lus10031593 [exp] 74 / 2e-17 AT4G27310 119 / 2e-33 B-box type zinc finger family protein (.1) Lus10033751 [exp] 74 / 5e-17 AT4G27310 114 / 9e-32 B-box type zinc finger family protein (.1) Lus10018513 [exp] 68 / 8e-15 AT4G27310 117 / 3e-32 B-box type zinc finger family protein (.1) Lus10039727 [exp] 68 / 1e-14 AT5G54470 118 / 1e-32 B-box type zinc finger family protein (.1) Lus10033380 [exp] 62 / 1e-12 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Lus10034830 [exp] 61 / 5e-12 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G121100 [exp] 121 / 1e-36 AT4G15248 108 / 2e-31 B-box type zinc finger family protein (.1) Potri.017G039400 [exp] 107 / 2e-31 AT4G15248 100 / 3e-28 B-box type zinc finger family protein (.1) Potri.013G150500 [exp] 75 / 1e-17 AT4G27310 114 / 1e-31 B-box type zinc finger family protein (.1) Potri.004G027100 [exp] 72 / 2e-17 AT5G54470 97 / 4e-26 B-box type zinc finger family protein (.1) Potri.004G026900 [exp] 68 / 2e-15 AT4G27310 109 / 2e-30 B-box type zinc finger family protein (.1) Potri.011G039700 [exp] 66 / 2e-14 AT4G27310 105 / 3e-28 B-box type zinc finger family protein (.1) Potri.001G414700 [exp] 66 / 6e-14 AT5G54470 126 / 2e-35 B-box type zinc finger family protein (.1) Potri.011G125400 [exp] 66 / 6e-14 AT5G54470 120 / 1e-32 B-box type zinc finger family protein (.1) Potri.008G007000 [exp] 64 / 4e-13 AT3G21150 128 / 3e-36 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Potri.004G027000 [exp] 61 / 5e-13 AT4G27310 91 / 5e-24 B-box type zinc finger family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [flax] [poplar] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Lus10015097 pacid=23149516 polypeptide=Lus10015097 locus=Lus10015097.g ID=Lus10015097.BGIv1.0 annot-version=v1.0 ATGTGCAGAGGACTTCTGCCACAAAGCAAAGCTGAGAGCTTCTGCAGAAAACCAGAAGCCGCCAGTGAAGTTGAGATCAGCTGTGTTGATGGTGCTTCTT CATCATCGAGAAAGTGTGAGCTGTGTGAAGAAAGGGCAAGACTTTACTGTGAAGCTGATGATGCATATCTGTGCCAAGAGTGCGACAGATATGTCCATGG TGCCAACTTCTTGGCTCTCAGACACGTTCGGTGCTTGCTGTGTAGCACCTGCCAAGGTTTCACTCAGAGGTACGTCGTCGGAGCTTCGATGGAGGTTGTG CTTCCCGGTACGGTGAAGGAAGAAGAACCAGAGAGTTCAGTTGAATTGCCATTCCTGTTTCTGTAA
AA sequence Show only first row Show all	>Lus10015097 pacid=23149516 polypeptide=Lus10015097 locus=Lus10015097.g ID=Lus10015097.BGIv1.0 annot-version=v1.0 MCRGLLPQSKAESFCRKPEAASEVEISCVDGASSSSRKCELCEERARLYCEADDAYLCQECDRYVHGANFLALRHVRCLLCSTCQGFTQRYVVGASMEVV LPGTVKEEEPESSVELPFLFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15248	CO		B-box type zinc finger family ...		Lus10015097 [exp]	0	1
AT1G66080			unknown protein		Lus10010967 [exp]	1.7	0.9455
AT5G49910		CPHSC70-2EATSHO...	HEAT SHOCK PROTEIN 70-7, chlor...		Lus10037357 [exp]	3.6	0.9505
AT3G24500		MBF1C, ATMBF1C	multiprotein bridging factor 1...		Lus10034592 [exp]	4.5	0.9463
AT2G47180		ATGOLS1	galactinol synthase 1 (.1)		Lus10031434 [exp]	6.0	0.9212
AT3G13130			unknown protein		Lus10038793 [exp]	6.5	0.9258
AT2G31670			Stress responsive alpha-beta b...		Lus10017873 [exp]	7.7	0.9152
AT1G64090		RTNLB3	Reticulan like protein B3 (.1....		Lus10017533 [exp]	9.2	0.8434
AT3G10020			unknown protein		Lus10003372 [exp]	9.2	0.9362
AT4G27940		ATMTM1	ARABIDOPSIS MANGANESE TRACKING...		Lus10014940 [exp]	9.9	0.8342
AT5G12020		HSP17.6II	17.6 kDa class II heat shock p...		Lus10025005 [exp]	11.0	0.9350

Compare expression of checked genes

Lus10015097 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.