Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03890 38 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039676 [exp] 43 / 7e-06 AT3G10120 56 / 2e-10 unknown protein Lus10027167 [exp] 39 / 0.0001 AT3G10120 52 / 4e-09 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10015117 pacid=23149525 polypeptide=Lus10015117 locus=Lus10015117.g ID=Lus10015117.BGIv1.0 annot-version=v1.0 ATGGGGAATTGCTTGATCTGCAGCCACAAGAAGAACAACAAGATCGTCTCGCTAGAAGATCACGACACACTCGATCGTCTGTTCGAAACAGCTCAAAAGG CCGCGGCGGATGATGCTGCCAATAAGGAGGAGGAGGAGGGGAAGAAGGTGACGAGGGTTCGAGTTTTGGTGACCAAACAAGAGCTGAGGGAAATCCTGAA CCGCGAGGGTTCGAATTTGGATAAAACGTCGTCGTCGTTGGCTTTGGAAGAGCTTTTGATGAGGAAGGTGAAGTTGAGGGAGTTTCATGAGATGTTTACC TCCGAAGACGACGATGACGTGGCGGTCGCTAATGGTGGGTGGAAGCCAGCTTTAGAGAGCATTCCTGAAGACAGTTAA
AA sequence Show only first row Show all	>Lus10015117 pacid=23149525 polypeptide=Lus10015117 locus=Lus10015117.g ID=Lus10015117.BGIv1.0 annot-version=v1.0 MGNCLICSHKKNNKIVSLEDHDTLDRLFETAQKAAADDAANKEEEEGKKVTRVRVLVTKQELREILNREGSNLDKTSSSLALEELLMRKVKLREFHEMFT SEDDDDVAVANGGWKPALESIPEDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03890			unknown protein		Lus10015117 [exp]	0	1
AT3G26170		CYP71B19	"cytochrome P450, family 71, s...		Lus10018261 [exp]	2.0	0.9711
AT1G56010	NAC	NAC1, ANAC021, ...	Arabidopsis NAC domain contain...		Lus10042466 [exp]	2.2	0.9601
AT3G05640			Protein phosphatase 2C family ...		Lus10037709 [exp]	2.4	0.9478
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10018262 [exp]	2.4	0.9645
AT5G57240		ORP4C	OSBP(oxysterol binding protein...		Lus10021603 [exp]	4.7	0.9399
AT1G16310			Cation efflux family protein (...		Lus10001768 [exp]	5.2	0.9638
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10006835 [exp]	8.2	0.9626
AT5G17840			DnaJ/Hsp40 cysteine-rich domai...		Lus10013632 [exp]	10.2	0.9435
AT1G09440			Protein kinase superfamily pro...		Lus10030863 [exp]	11.0	0.9403
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10010652 [exp]	11.0	0.9449

Compare expression of checked genes

Lus10015117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.