Lus10015121 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03800 277 / 6e-93 ATSYP131, SYP131 syntaxin of plants 131 (.1)
AT5G08080 259 / 9e-86 ATSYP132, SYP132 syntaxin of plants 132 (.1.2.3)
AT1G11250 212 / 1e-67 ATSYP125, SYP125 syntaxin of plants 125 (.1)
AT1G61290 204 / 2e-64 ATSYP124, SYP124 syntaxin of plants 124 (.1)
AT4G03330 203 / 5e-64 ATSYP123, SYP123 syntaxin of plants 123 (.1)
AT3G11820 194 / 3e-60 PEN1, AT-SYR1, ATSYR1, ATSYP121, SYP121 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
AT3G52400 187 / 2e-57 ATSYP122, SYP122 syntaxin of plants 122 (.1)
AT1G08560 154 / 6e-45 KN, ATSYP111, SYP111 KNOLLE, syntaxin of plants 111 (.1)
AT2G18260 123 / 4e-33 ATSYP112, SYP112 syntaxin of plants 112 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031553 457 / 7e-164 AT3G03800 347 / 4e-120 syntaxin of plants 131 (.1)
Lus10010655 268 / 1e-89 AT3G03800 432 / 6e-154 syntaxin of plants 131 (.1)
Lus10006735 207 / 1e-65 AT1G61290 491 / 3e-177 syntaxin of plants 124 (.1)
Lus10013589 202 / 1e-63 AT3G11820 437 / 2e-155 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
Lus10021263 202 / 5e-63 AT3G11820 436 / 3e-154 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
Lus10018441 201 / 6e-63 AT1G61290 491 / 4e-177 syntaxin of plants 124 (.1)
Lus10020089 202 / 7e-63 AT1G61290 467 / 2e-166 syntaxin of plants 124 (.1)
Lus10011244 198 / 6e-62 AT1G61290 487 / 2e-175 syntaxin of plants 124 (.1)
Lus10029373 194 / 4e-60 AT3G11820 441 / 4e-157 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G123000 347 / 1e-119 AT3G03800 300 / 1e-100 syntaxin of plants 131 (.1)
Potri.019G036700 285 / 6e-96 AT3G03800 391 / 1e-137 syntaxin of plants 131 (.1)
Potri.004G035400 213 / 9e-68 AT1G61290 490 / 8e-177 syntaxin of plants 124 (.1)
Potri.011G043700 211 / 2e-67 AT1G61290 456 / 3e-163 syntaxin of plants 124 (.1)
Potri.013G053200 202 / 3e-63 AT1G08560 430 / 8e-153 KNOLLE, syntaxin of plants 111 (.1)
Potri.019G030800 197 / 1e-61 AT1G08560 431 / 3e-153 KNOLLE, syntaxin of plants 111 (.1)
Potri.016G068600 193 / 3e-60 AT3G11820 421 / 5e-149 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
Potri.006G202200 192 / 6e-60 AT3G11820 412 / 3e-145 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2)
Potri.007G023100 147 / 3e-42 AT2G18260 352 / 3e-122 syntaxin of plants 112 (.1)
Potri.009G117900 136 / 3e-38 AT2G18260 298 / 4e-101 syntaxin of plants 112 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0445 SNARE-fusion PF00804 Syntaxin Syntaxin
CL0445 PF05739 SNARE SNARE domain
Representative CDS sequence
>Lus10015121 pacid=23149570 polypeptide=Lus10015121 locus=Lus10015121.g ID=Lus10015121.BGIv1.0 annot-version=v1.0
ATGAACGACCTGCTCACGGACTCGTTTGTGGGTCAAACCAACCGGGGACAGAACAATGATATCGAAATGGGAGTGCAAAGTCCCAGTCCTAGTCAGAGCT
CCAGGAGTATCTCTGATATGGGAATGGGAAGTTTCAACAAGCAGATACAAGAAGTCGAGAAAAATGTCGACAAAGTTGCTGGCCTGCTGAAGAGTTTGAA
GGATGCTAACGAGGAGTCGAAGACTGTCACGAAAGCTTCGGCTATGAAAGCCATCAAGAAGCGAATGGAGAAGGACATCGACGAAGTTGGCAAGACAGCA
CGTTTCGTCAAAGCCAAACTCGAAGCAATAAACAAAGATAACTTAGCAAATCGGCAGAAGCCTGGCTGCGAGAAGGGTACCGGTGTTGACAGAGCTAGGA
TGAATGTTACAAATTCGTTAACGAAGAAGTTTAGAGATCTGATGACTGAGTTTCAGACCCTAAGGCAAAAGATACAAGACGAATATCGTGAGGTTGTCGA
GCGAAGAGTCATGACAGTTACTGGAGCTAAACCGGATGAAGAGACAATCGACCAACTGATTGAAACGGGAGACAGTGAGCAGATCTTTCAAAATGCGATC
CAAGAAATGGGTCGAGGACAGGTGCTGAACACGGTGCAAGAAATCCACGAGAGGCATGATGCGGTGAAGGAAATCGAAAAGAAGCTCCTCGACTTACACC
AAATATACCTTGACATGGCTGTACTCGTCGAGGCTCAGGGAGAGATACTAGACAACATCGAGAACCAGAGGTATAAGTATTTGATTGGAGGGGTTGTTAG
AATTCATTTCGGTGCAATTTACGGAGTTTCGTGTTGGTTGGACAAGGTTCGTGATGAGTAG
AA sequence
>Lus10015121 pacid=23149570 polypeptide=Lus10015121 locus=Lus10015121.g ID=Lus10015121.BGIv1.0 annot-version=v1.0
MNDLLTDSFVGQTNRGQNNDIEMGVQSPSPSQSSRSISDMGMGSFNKQIQEVEKNVDKVAGLLKSLKDANEESKTVTKASAMKAIKKRMEKDIDEVGKTA
RFVKAKLEAINKDNLANRQKPGCEKGTGVDRARMNVTNSLTKKFRDLMTEFQTLRQKIQDEYREVVERRVMTVTGAKPDEETIDQLIETGDSEQIFQNAI
QEMGRGQVLNTVQEIHERHDAVKEIEKKLLDLHQIYLDMAVLVEAQGEILDNIENQRYKYLIGGVVRIHFGAIYGVSCWLDKVRDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03800 ATSYP131, SYP13... syntaxin of plants 131 (.1) Lus10015121 0 1
AT5G61530 small G protein family protein... Lus10042986 1.4 0.8645
AT3G24740 Protein of unknown function (D... Lus10011876 2.4 0.8569
AT5G16110 unknown protein Lus10009170 5.2 0.8385
AT3G24740 Protein of unknown function (D... Lus10022809 5.9 0.8186
AT1G03080 kinase interacting (KIP1-like)... Lus10006896 8.5 0.8034
AT3G26100 Regulator of chromosome conden... Lus10006455 9.6 0.7893
AT3G47300 SELT SELT-like protein precursor (.... Lus10040658 9.8 0.8245
AT3G01910 AT-SO, ATSO, SO... sulfite oxidase (.1.2.3) Lus10041560 12.0 0.7676
AT1G03400 2-oxoglutarate (2OG) and Fe(II... Lus10007818 13.3 0.7710
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10028867 16.7 0.8164

Lus10015121 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.