Lus10015123 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17880 214 / 4e-72 ATBTF3 basic transcription factor 3 (.1)
AT1G73230 199 / 3e-66 Nascent polypeptide-associated complex NAC (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031551 253 / 7e-88 AT1G17880 255 / 2e-88 basic transcription factor 3 (.1)
Lus10039661 238 / 2e-81 AT1G17880 253 / 2e-87 basic transcription factor 3 (.1)
Lus10027180 201 / 5e-67 AT1G17880 238 / 1e-81 basic transcription factor 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G078300 230 / 1e-78 AT1G73230 197 / 2e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.017G141100 221 / 4e-75 AT1G73230 196 / 3e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.015G029800 185 / 1e-60 AT1G17880 232 / 4e-79 basic transcription factor 3 (.1)
Potri.012G037900 181 / 3e-59 AT1G73230 225 / 1e-76 Nascent polypeptide-associated complex NAC (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Lus10015123 pacid=23149603 polypeptide=Lus10015123 locus=Lus10015123.g ID=Lus10015123.BGIv1.0 annot-version=v1.0
ATGAATCGGGAGAAGCTAATGAAGATGGCCGGCTCCGTTCGTACCGGAGGAAAGGGAACCGTCCGAAGAAAGAAGAAGGCTGTCCACAAATCGACCACCA
CCGACGATAAGAAGCTTCAGAACACACTGAAGAGGATAGGTGTCAACACCATCCCGGCTATTGAAGAAGTCAACATCTTTAAGGATGATTTGGTGATTCA
GTTTGTTAACCCTAAAGTTCAGGCCTCAGTTGTTGCCAACACTTGGGTTATCACTGGTTCTCCTCAGACCAGAAAACTTCAAGATATTCTTCCAGGAATC
ATCAACCAGCTTGGTCCGGACAACTTGGACAACCTCAAGAAGTTGGCTGAGCAGTTCCAAAAGGAGGCTCCAGGGGCTACCTTGGGAGCAGTCCAGGAGG
AAGATGATGATGATGTCCCGGAACTCGTAGCAGGGGAGACATTTGAAGCTGCAGCAGCAGAAGAAACTAAAGCTTAA
AA sequence
>Lus10015123 pacid=23149603 polypeptide=Lus10015123 locus=Lus10015123.g ID=Lus10015123.BGIv1.0 annot-version=v1.0
MNREKLMKMAGSVRTGGKGTVRRKKKAVHKSTTTDDKKLQNTLKRIGVNTIPAIEEVNIFKDDLVIQFVNPKVQASVVANTWVITGSPQTRKLQDILPGI
INQLGPDNLDNLKKLAEQFQKEAPGATLGAVQEEDDDDVPELVAGETFEAAAAEETKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10015123 0 1
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10040332 2.0 0.9719
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10015588 5.3 0.9673
AT2G42740 RPL16A ribosomal protein large subuni... Lus10033607 5.5 0.9664
AT3G49470 NACA2 nascent polypeptide-associated... Lus10015579 6.7 0.9453
AT2G31610 Ribosomal protein S3 family pr... Lus10012857 8.0 0.9644
AT2G42740 RPL16A ribosomal protein large subuni... Lus10017648 8.8 0.9563
AT1G48830 Ribosomal protein S7e family p... Lus10028789 8.8 0.9558
AT1G74050 Ribosomal protein L6 family pr... Lus10039084 12.2 0.9563
AT5G20600 unknown protein Lus10011961 13.5 0.9069
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10038908 14.4 0.9456

Lus10015123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.