Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27130 209 / 8e-72 Translation initiation factor SUI1 family protein (.1) AT5G54760 207 / 4e-71 Translation initiation factor SUI1 family protein (.1.2.3) AT1G54290 207 / 6e-71 Translation initiation factor SUI1 family protein (.1) AT5G54940 164 / 6e-54 Translation initiation factor SUI1 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031550 [exp] 226 / 7e-78 AT4G27130 207 / 2e-70 Translation initiation factor SUI1 family protein (.1) Lus10039660 [exp] 214 / 1e-73 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10027181 [exp] 214 / 1e-73 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10021532 [exp] 152 / 5e-49 AT5G54940 169 / 9e-56 Translation initiation factor SUI1 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G122700 [exp] 210 / 5e-72 AT4G27130 217 / 5e-75 Translation initiation factor SUI1 family protein (.1) Potri.011G134700 [exp] 209 / 6e-72 AT4G27130 213 / 3e-73 Translation initiation factor SUI1 family protein (.1) Potri.007G122600 [exp] 208 / 2e-71 AT4G27130 215 / 3e-74 Translation initiation factor SUI1 family protein (.1) Potri.001G418600 [exp] 205 / 4e-70 AT1G54290 218 / 2e-75 Translation initiation factor SUI1 family protein (.1) Potri.017G037100 [exp] 187 / 4e-63 AT1G54290 187 / 2e-63 Translation initiation factor SUI1 family protein (.1) Potri.010G151700 [exp] 161 / 8e-53 AT5G54940 170 / 2e-56 Translation initiation factor SUI1 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01253 [flax] [poplar] SUI1 Translation initiation factor SUI1
Representative CDS sequence Show only first row Show all	>Lus10015124 pacid=23149493 polypeptide=Lus10015124 locus=Lus10015124.g ID=Lus10015124.BGIv1.0 annot-version=v1.0 ATGTCTTTTGACGAACAGATCGCAACCCCTTTCGATCCTTTTGCTGATGCAAATGCTGAGGACTCGGGCGCTGGTACAAAAGAGTACGTCCACATCCGGA TCCAGCAGAGAAATGGAAGGAAGAGCTTGACGACTGTGCAAGGGTTGAAGAAGGACTTCAGCTATAACAAGATACTAAAGGACCTGAAGAAGGAGTTCTG CTGTAATGGTACTGTCGTCCAGGACCCTGAGTTAGGCCAGGTGATCCAGCTTCAAGGTGACCAGAGGAAGAACGTCTCCACGTTCCTCGTTCAGGCTGGA ATTGTGAAGAAGGATAACATCAAGATCCATGGTTTCTAA
AA sequence Show only first row Show all	>Lus10015124 pacid=23149493 polypeptide=Lus10015124 locus=Lus10015124.g ID=Lus10015124.BGIv1.0 annot-version=v1.0 MSFDEQIATPFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAG IVKKDNIKIHGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27130			Translation initiation factor ...		Lus10015124 [exp]	0	1
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10018843 [exp]	1.0	0.9537
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10021515 [exp]	2.0	0.9456
AT2G26070		RTE1	REVERSION-TO-ETHYLENE SENSITIV...		Lus10030001 [exp]	5.9	0.9401
AT1G67910			unknown protein		Lus10034901 [exp]	6.2	0.9019
AT2G32090			Lactoylglutathione lyase / gly...		Lus10006122 [exp]	6.7	0.9436
AT1G28560		SRD2	SHOOT REDIFFERENTIATION DEFECT...		Lus10017968 [exp]	6.9	0.9264
AT5G54940			Translation initiation factor ...		Lus10021532 [exp]	6.9	0.9164
AT1G68000		ATPIS1	phosphatidylinositol synthase ...		Lus10014117 [exp]	7.0	0.9278
AT4G27130			Translation initiation factor ...		Lus10027181 [exp]	7.2	0.9403
AT4G33690			unknown protein		Lus10040497 [exp]	10.4	0.9257

Compare expression of checked genes

Lus10015124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.