Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32360 61 / 1e-12 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031549 [exp] 177 / 1e-57 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10027183 [exp] 93 / 6e-26 AT2G32360 66 / 9e-15 Ubiquitin-like superfamily protein (.1) Lus10039658 [exp] 86 / 4e-23 AT2G32360 69 / 4e-16 Ubiquitin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G122500 [exp] 94 / 2e-26 AT2G32360 66 / 2e-14 Ubiquitin-like superfamily protein (.1) Potri.017G037500 [exp] 87 / 7e-24 AT2G32360 67 / 2e-15 Ubiquitin-like superfamily protein (.1) Potri.017G037400 [exp] 0 / 1 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10015125 pacid=23149546 polypeptide=Lus10015125 locus=Lus10015125.g ID=Lus10015125.BGIv1.0 annot-version=v1.0 ATGATGGTGGTGGTGGAGATATTGACAGGCAATCTCTTCCATGTTGATGTAAAGGAAGATGGCACGGTTGGCGATCTACGACGAGCCATCTCCGAGCAGC AGAAGCTCCCCGTTGATCGCCTAATACTGATCCTAATGCATTCTGATGGGAGCGTGACTCGTTTGATTGCGAATGAAGACAATCAAGGCGGGAATGATGG TGGTTTATCTCTTGCTGAATTTGGTGTTCATGATGGCTCTCATATTTATCTCTTCTTCACTCCTTTAGATGATGATGATTATGGATTTTCTCACAACTTT GATTTCACTTGGCCTGAAGTCTTCTTGAGTTGA
AA sequence Show only first row Show all	>Lus10015125 pacid=23149546 polypeptide=Lus10015125 locus=Lus10015125.g ID=Lus10015125.BGIv1.0 annot-version=v1.0 MMVVVEILTGNLFHVDVKEDGTVGDLRRAISEQQKLPVDRLILILMHSDGSVTRLIANEDNQGGNDGGLSLAEFGVHDGSHIYLFFTPLDDDDYGFSHNF DFTWPEVFLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32360			Ubiquitin-like superfamily pro...		Lus10015125 [exp]	0	1
AT5G14345		AtENODL21	early nodulin-like protein 21 ...		Lus10032111 [exp]	6.3	0.9012
AT1G78610		MSL6	mechanosensitive channel of sm...		Lus10012516 [exp]	7.2	0.8858
AT1G30050			unknown protein		Lus10035609 [exp]	7.5	0.9367
AT3G03080			Zinc-binding dehydrogenase fam...		Lus10003638 [exp]	10.6	0.9356
					Lus10041024 [exp]	13.2	0.9323
					Lus10009618 [exp]	15.9	0.9283
					Lus10007507 [exp]	16.9	0.9260
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	17.7	0.9283
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	19.4	0.9283
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039085 [exp]	21.0	0.9283

Compare expression of checked genes

Lus10015125 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.