Lus10015132 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42570 225 / 6e-75 B-cell receptor-associated 31-like (.1)
AT1G11905 169 / 9e-53 B-cell receptor-associated protein 31-like (.1.2)
AT5G48660 114 / 2e-31 B-cell receptor-associated protein 31-like (.1)
AT3G07190 103 / 3e-27 B-cell receptor-associated protein 31-like (.1)
AT3G20450 100 / 8e-27 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031546 323 / 2e-113 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1)
Lus10030043 221 / 2e-73 AT5G42570 241 / 1e-81 B-cell receptor-associated 31-like (.1)
Lus10035283 196 / 1e-63 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Lus10020025 174 / 9e-55 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10011842 119 / 3e-33 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10038188 117 / 1e-32 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Lus10022777 115 / 1e-31 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Lus10000048 48 / 3e-07 AT1G11905 81 / 3e-20 B-cell receptor-associated protein 31-like (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G007200 208 / 3e-68 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1)
Potri.004G007900 204 / 1e-66 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1)
Potri.014G154800 184 / 1e-58 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
Potri.014G191500 127 / 2e-36 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.002G245300 127 / 3e-36 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
Potri.011G089100 122 / 2e-35 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
PFAM info
Representative CDS sequence
>Lus10015132 pacid=23149541 polypeptide=Lus10015132 locus=Lus10015132.g ID=Lus10015132.BGIv1.0 annot-version=v1.0
ATGGCGGTGATTCTGACGCTGCTGTTCAAGACGCCGCTGCGGAAGCTGGTGATCGTGGCGCTGGATCGGGTCAAGCGCGGGAGAGGCCCCGTCATGGTGA
AGACCGTCTCCGGGACGGTGTTCGTCGTCCTCTGCTCCAGCCTTTACAGTATGGTCACGATTCAGAATCGCTCCATCGAGGCCGGCTCTCCCAATCCTAC
CGATCAGGTTCTCGAGTCCACGCACCTGCTCGAAGCCTCTCTCATGGGTAAAACAGTCTGCCTTAAATCTGCTCACGGGTTTCTGCTTTTTCTCGCGCTG
ATGATTGACAGGCTGCACTACTACATCAGGGAGCTCCGCCAGCTAAGGAAGACGATGGAAGCCGTGAAGAAGCAGACTCAAGGTCTCGACGATAGCAAAA
GCAGCAGCAGCAACAACCCAGATGAGCTCAAAGCACTAGGAGAAGAGGTTGCTACCCTACGCAGCAAGGTGAAGAAGATGGAAGCCGAATGTGAAGCCAA
GACAAAGGAAGCTAAGGCCGCAGCTGAGAAAGCTGGTGCTGTGAGGAAACAAACCGAAGGGTTTATTCAAGACTACGAGCAATTACAAGAAGACAACCAG
AACCTCCGTAGCCAGATCGAGTCGTTAGAATCTGAGGGCAAGAAGGATATGTGA
AA sequence
>Lus10015132 pacid=23149541 polypeptide=Lus10015132 locus=Lus10015132.g ID=Lus10015132.BGIv1.0 annot-version=v1.0
MAVILTLLFKTPLRKLVIVALDRVKRGRGPVMVKTVSGTVFVVLCSSLYSMVTIQNRSIEAGSPNPTDQVLESTHLLEASLMGKTVCLKSAHGFLLFLAL
MIDRLHYYIRELRQLRKTMEAVKKQTQGLDDSKSSSSNNPDELKALGEEVATLRSKVKKMEAECEAKTKEAKAAAEKAGAVRKQTEGFIQDYEQLQEDNQ
NLRSQIESLESEGKKDM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42570 B-cell receptor-associated 31-... Lus10015132 0 1
AT5G27920 F-box family protein (.1) Lus10029869 84.1 0.7941
AT1G54740 Protein of unknown function (D... Lus10035353 156.9 0.7728
AT3G13780 SMAD/FHA domain-containing pro... Lus10037628 183.0 0.7561
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10040732 184.4 0.7623
AT5G13070 MSF1-like family protein (.1) Lus10031261 223.9 0.7516
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Lus10023131 279.3 0.7421

Lus10015132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.