Plant FIBer expression Database

Lus10015142 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32640 306 / 3e-102 Lycopene beta/epsilon cyclase protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031537
[exp]
388 / 1e-134 AT2G32640 783 / 0.0 Lycopene beta/epsilon cyclase protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156800
[exp]
339 / 6e-115 AT2G32640 798 / 0.0 Lycopene beta/epsilon cyclase protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10015142 pacid=23149602 polypeptide=Lus10015142 locus=Lus10015142.g ID=Lus10015142.BGIv1.0 annot-version=v1.0
ATGAGTCGTCAATTTTACTGTTTTCTCTACTCTGATGATCAGTTTGGAGATGCAAGTGGCATACAGTCACCTGTTTCGTTCGGTGGTTTCGGAAGCTTAA
CGAGACACCTGGGGAGACTTTCATCTGGTATATATGAAGCAATCAATGGAGATTTCCTCGATGCAGAAAGCTTGTCCCTTTTGAATCCTTACATGCCGAA
CTTGAGCGCTTCGTGGCTGTTCCAAAGAGCTATGTCGGCCAAGCAAGACTCGAATGCTTATCCCGAATTCGTCAATGACCTTCTTCATGTCAATTTCCAG
AGTATGCAGAAGCTGGGAGATCCAGTCCTGAGACCATTTCTTCAGGATGTTATACAGTTTGGTGCTCTTACTAAGACATTAGGACTTGTTATGTTGAACA
AACCCCAAATCATCCCGTCAATATTCAAGCAGGTCGGGATTCGGGTGCTTGTAGATTGGTCAGGCCATTTCTTCATGCTAGGTCTTTACACTTTCCTTTC
AACATTTGCTGATCCTGCTATTCGGCAATTGTTGAGCTCCTCTCCATCGAAGACCAAGTATGCATGGAACCGGCGTCTCGATGCTTGGAAATATGGTTCT
GGTTTAGACTACAAGCTTTGA
AA sequence
>Lus10015142 pacid=23149602 polypeptide=Lus10015142 locus=Lus10015142.g ID=Lus10015142.BGIv1.0 annot-version=v1.0
MSRQFYCFLYSDDQFGDASGIQSPVSFGGFGSLTRHLGRLSSGIYEAINGDFLDAESLSLLNPYMPNLSASWLFQRAMSAKQDSNAYPEFVNDLLHVNFQ
SMQKLGDPVLRPFLQDVIQFGALTKTLGLVMLNKPQIIPSIFKQVGIRVLVDWSGHFFMLGLYTFLSTFADPAIRQLLSSSPSKTKYAWNRRLDAWKYGS
GLDYKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32640 Lycopene beta/epsilon cyclase ... Lus10015142
[exp]
0 1
AT4G25830 Uncharacterised protein family... Lus10015528
[exp]
4.2 0.9079
AT3G26060 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin s... Lus10034892
[exp]
5.8 0.9193
AT2G32640 Lycopene beta/epsilon cyclase ... Lus10015143
[exp]
6.9 0.9081
AT3G55800 SBPASE sedoheptulose-bisphosphatase (... Lus10040228
[exp]
7.3 0.9233
AT1G74880 NdhO, NDH-O NADH dehydrogenase-like comple... Lus10000828
[exp]
11.0 0.9152
AT2G33580 Protein kinase superfamily pro... Lus10041171
[exp]
13.2 0.9111
AT1G78600 CO BBX22, DBB3, ST... SALT TOLERANCE HOMOLOG 3, DOUB... Lus10038147
[exp]
14.9 0.8782
AT4G25830 Uncharacterised protein family... Lus10019999
[exp]
15.2 0.8842
AT2G04700 ferredoxin thioredoxin reducta... Lus10039449
[exp]
15.3 0.9129
Lus10005720
[exp]
16.2 0.9148

Lus10015142 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.