Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031533 [exp] 63 / 2e-13 AT1G47790 57 / 2e-09 F-box and associated interaction domains-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G142000 [exp] 38 / 0.0003 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142300 [exp] 37 / 0.0007 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [flax] [poplar] Chitin_bind_1 Chitin recognition protein
Representative CDS sequence Show only first row Show all	>Lus10015147 pacid=23149536 polypeptide=Lus10015147 locus=Lus10015147.g ID=Lus10015147.BGIv1.0 annot-version=v1.0 ATGGGAGCGAAGAAGGAGAAGCAGGTGGGAGTCATAGTTTGGGCAGTCTTAGTACTGATATTGCTGCAGCAGGTGGGCAAAACTGCGAGTACTGTGGAGG ATGACAAGGGCTACTATCGTTGCGACAAAGGTATCAGCTGGGCAAAGTGTCCCCCGGGGCTATGCTGCCGGAACGATGGCTACTGTGGAACCACTGATAG CTTCTGCGGCGCCGACAATTGTCAAGATTCGTGCCACCCCTCGCCAGGCTCCGGCAGCCCTTGA
AA sequence Show only first row Show all	>Lus10015147 pacid=23149536 polypeptide=Lus10015147 locus=Lus10015147.g ID=Lus10015147.BGIv1.0 annot-version=v1.0 MGAKKEKQVGVIVWAVLVLILLQQVGKTASTVEDDKGYYRCDKGISWAKCPPGLCCRNDGYCGTTDSFCGADNCQDSCHPSPGSGSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10015147 [exp]	0	1
AT4G37390		AUR3, YDK1, GH3...	YADOKARI 1, AUXIN UPREGULATED ...		Lus10014869 [exp]	6.2	0.8736
AT5G38200			Class I glutamine amidotransfe...		Lus10016700 [exp]	7.5	0.8692
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10020713 [exp]	14.8	0.8589
AT2G24610		ATCNGC14	cyclic nucleotide-gated channe...		Lus10020122 [exp]	17.2	0.8466
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10013282 [exp]	17.3	0.8426
AT2G43610			Chitinase family protein (.1)		Lus10025948 [exp]	21.2	0.8492
AT3G58880			F-box/RNI-like superfamily pro...		Lus10035669 [exp]	23.6	0.8509
					Lus10033677 [exp]	28.0	0.8171
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015746 [exp]	28.9	0.8278
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10021002 [exp]	34.7	0.8435

Compare expression of checked genes

Lus10015147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.