Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34280 45 / 2e-06 F-box and associated interaction domains-containing protein (.1) AT3G52320 44 / 8e-06 F-box and associated interaction domains-containing protein (.1) AT5G50220 42 / 2e-05 F-box family protein (.1) AT5G10340 42 / 4e-05 F-box family protein (.1) AT4G21240 42 / 5e-05 F-box and associated interaction domains-containing protein (.1) AT4G09190 41 / 7e-05 F-box and associated interaction domains-containing protein (.1) AT1G30780 41 / 7e-05 F-box associated ubiquitination effector family protein (.1) AT1G32420 41 / 7e-05 F-box and associated interaction domains-containing protein (.1) AT3G17270 40 / 8e-05 F-box family protein (.1) AT5G15670 40 / 0.0001 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010910 [exp] 98 / 5e-25 AT3G23880 101 / 1e-23 F-box and associated interaction domains-containing protein (.1) Lus10043335 [exp] 91 / 4e-23 AT4G12560 84 / 2e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031512 [exp] 92 / 6e-23 AT3G16210 100 / 8e-23 F-box family protein (.1) Lus10031480 [exp] 79 / 5e-18 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031478 [exp] 79 / 5e-18 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10000190 [exp] 79 / 5e-18 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031493 [exp] 76 / 4e-17 AT3G05500 285 / 4e-96 Rubber elongation factor protein (REF) (.1) Lus10040463 [exp] 74 / 2e-16 AT4G12560 117 / 7e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10025893 [exp] 69 / 6e-15 AT1G11270 49 / 7e-07 F-box and associated interaction domains-containing protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G013000 [exp] 56 / 5e-10 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.016G012700 [exp] 47 / 5e-07 AT4G12560 143 / 3e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G458400 [exp] 47 / 5e-07 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1) Potri.006G012900 [exp] 47 / 5e-07 AT4G12560 144 / 2e-39 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.005G043500 [exp] 47 / 9e-07 AT5G07610 135 / 7e-36 F-box family protein (.1) Potri.001G318400 [exp] 46 / 9e-07 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.010G154500 [exp] 46 / 1e-06 AT4G12560 139 / 7e-37 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G010800 [exp] 45 / 3e-06 AT4G12560 159 / 2e-44 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.005G114900 [exp] 45 / 4e-06 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1) Potri.012G014700 [exp] 45 / 4e-06 AT1G12170 66 / 1e-11 F-box family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10015170 pacid=23149497 polypeptide=Lus10015170 locus=Lus10015170.g ID=Lus10015170.BGIv1.0 annot-version=v1.0 ATGTCGTTGGACCTAATTCCAGAAGAAATCATGGCCAACATTCTGGCACAGCTTAGGGCGAAGGATCTCGTCAATTGGAGGAGCGTATCGAAGCAGTGGC TCTCGATAATCGACGACCGTCACTTCATCCGTAGCCAACTCCAACATTCCCTTTCGACAAATTCCAACTCCGCCCTTTTCCTCCAAGACAGAATAGTTAC TGACGATAAACTGAAAGCTTATGGTTTTGGATACGATGAATTATCAGCCGATTACAAGGTGGCCAGGATTTTACAAGAAAGGTCTGATGATCCCAACATT AATCTTTGCTACATTGCTGAAATCTACGGGCTCAGGTCCAAGGGTTTCGTCAGGACGATTCCTTTGCCCGATGCAGATTAG
AA sequence Show only first row Show all	>Lus10015170 pacid=23149497 polypeptide=Lus10015170 locus=Lus10015170.g ID=Lus10015170.BGIv1.0 annot-version=v1.0 MSLDLIPEEIMANILAQLRAKDLVNWRSVSKQWLSIIDDRHFIRSQLQHSLSTNSNSALFLQDRIVTDDKLKAYGFGYDELSADYKVARILQERSDDPNI NLCYIAEIYGLRSKGFVRTIPLPDAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50220			F-box family protein (.1)		Lus10015170 [exp]	0	1
AT3G22680		RDM1	RNA-DIRECTED DNA METHYLATION 1...		Lus10003012 [exp]	5.2	0.9318
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10038261 [exp]	8.3	0.8870
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10006840 [exp]	9.1	0.8418
					Lus10021782 [exp]	9.1	0.9123
					Lus10023587 [exp]	11.1	0.9123
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	12.8	0.9123
AT3G19540			Protein of unknown function (D...		Lus10028040 [exp]	14.3	0.9123
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10031542 [exp]	15.7	0.9123
AT1G48120			hydrolases;protein serine/thre...		Lus10015869 [exp]	16.9	0.9123
AT3G47570			Leucine-rich repeat protein ki...		Lus10030851 [exp]	17.0	0.9057

Compare expression of checked genes

Lus10015170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.