Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05490 89 / 3e-24 RALFL22 ralf-like 22 (.1) AT4G15800 89 / 3e-24 RALFL33 ralf-like 33 (.1) AT3G16570 87 / 3e-23 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT1G02900 83 / 8e-22 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT2G33775 67 / 8e-16 RALFL19 ralf-like 19 (.1) AT4G13950 67 / 1e-15 RALFL31 ralf-like 31 (.1) AT1G28270 66 / 5e-15 RALFL4 ralf-like 4 (.1) AT3G23805 65 / 1e-14 RALFL24 ralf-like 24 (.1) AT5G67070 54 / 4e-10 RALFL34 ralf-like 34 (.1) AT1G61566 42 / 5e-06 RALFL9 ralf-like 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020647 [exp] 100 / 2e-28 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10029893 [exp] 97 / 4e-27 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10000502 [exp] 81 / 6e-21 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10037512 [exp] 80 / 1e-20 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10016646 [exp] 68 / 6e-16 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10022561 [exp] 66 / 3e-15 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10015316 [exp] 63 / 7e-14 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10015431 [exp] 63 / 7e-14 AT1G28270 81 / 7e-21 ralf-like 4 (.1) Lus10025444 [exp] 62 / 8e-14 AT1G28270 100 / 2e-28 ralf-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G025800 [exp] 88 / 9e-24 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.013G017400 [exp] 87 / 2e-23 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.008G208200 [exp] 86 / 4e-23 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.014G131800 [exp] 86 / 7e-23 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.004G044900 [exp] 77 / 2e-19 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 77 / 2e-19 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.017G059500 [exp] 65 / 2e-14 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.001G320700 [exp] 61 / 3e-13 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.014G026900 [exp] 55 / 1e-10 AT5G67070 94 / 6e-26 ralf-like 34 (.1) Potri.007G044700 [exp] 53 / 7e-10 AT5G67070 119 / 1e-35 ralf-like 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10015172 pacid=23149577 polypeptide=Lus10015172 locus=Lus10015172.g ID=Lus10015172.BGIv1.0 annot-version=v1.0 ATGTCAGGCAATGGTAGTTTGATCCTCTTTGCCACAGTCTTGATTGCTCTGTTTCTCGCCGGAGATGTCGCGGCCGGCGGCGGAGGAGGAGAAGGGTGGA TGCCGATGAGGACGGTTGGGGAAGTTGGAGAAGTGGAGGAGTTTGGGATGGAGTCGGAGATCAGCAGGAGGGTGCTGCAGCAATCGAACGGGAGGTACAT AAGCTACGGTGCGTTGCAGAGGAACACGGTCCCGTGTTCGAACCGGGGAGCTTCATACTACAATTGCCAGAGTGGTGGCCAGGCTAACCCTTACCAGCGT GGATGCAGCGCCATTACTAGGTGCAGAAGCTAG
AA sequence Show only first row Show all	>Lus10015172 pacid=23149577 polypeptide=Lus10015172 locus=Lus10015172.g ID=Lus10015172.BGIv1.0 annot-version=v1.0 MSGNGSLILFATVLIALFLAGDVAAGGGGGEGWMPMRTVGEVGEVEEFGMESEISRRVLQQSNGRYISYGALQRNTVPCSNRGASYYNCQSGGQANPYQR GCSAITRCRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10015172 [exp]	0	1
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10020019 [exp]	3.5	0.9110
AT3G01690			alpha/beta-Hydrolases superfam...		Lus10014890 [exp]	6.0	0.8591
AT1G01490			Heavy metal transport/detoxifi...		Lus10007911 [exp]	8.5	0.8682
AT1G30110		ATNUDX25	nudix hydrolase homolog 25 (.1...		Lus10003714 [exp]	12.0	0.8711
AT3G11150			2-oxoglutarate (2OG) and Fe(II...		Lus10028972 [exp]	14.1	0.8367
AT5G40760		G6PD6	glucose-6-phosphate dehydrogen...		Lus10032079 [exp]	23.5	0.8145
AT3G05010			Protein of unknown function, t...		Lus10033835 [exp]	26.3	0.8179
AT4G13530			unknown protein		Lus10041074 [exp]	26.8	0.8217
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10016637 [exp]	28.0	0.8365
AT4G08230			glycine-rich protein (.1.2)		Lus10041619 [exp]	32.8	0.8355

Compare expression of checked genes

Lus10015172 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.