Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27700 151 / 1e-49 Ribosomal protein S21e (.1) AT3G53890 145 / 2e-47 Ribosomal protein S21e (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020645 [exp] 168 / 3e-56 AT5G27700 151 / 7e-50 Ribosomal protein S21e (.1) Lus10010971 [exp] 137 / 7e-43 AT5G27700 128 / 7e-39 Ribosomal protein S21e (.1) Lus10031494 [exp] 98 / 1e-28 AT5G27700 89 / 2e-25 Ribosomal protein S21e (.1) Lus10029895 [exp] 0 / 1 AT5G27700 85 / 2e-32 Ribosomal protein S21e (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G017600 [exp] 160 / 2e-53 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1) Potri.005G026000 [exp] 160 / 2e-53 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01249 [flax] [poplar] Ribosomal_S21e Ribosomal protein S21e
Representative CDS sequence Show only first row Show all	>Lus10015173 pacid=23149511 polypeptide=Lus10015173 locus=Lus10015173.g ID=Lus10015173.BGIv1.0 annot-version=v1.0 ATGCAGAACGAAGAAGGTCAGAACGTGGATCTCTACATCCCGAGGAAATGCTCGGCCACCAACAGGCTGATTACCTCCAAGGATCACGCTTCCGTCCAGA TTAACGTCGGTCATTTGGATGCTACCGGCCGTTACACTGGCCAGTTCACTACTTTTGCTCTCTGTGGATTCGTCCGTGCTCAGGGTGATGGAGACAGTGG ACTCGACAGGCTGTGGCAAAAGAAAAAGGCAGAGCTTCGCCAGTGA
AA sequence Show only first row Show all	>Lus10015173 pacid=23149511 polypeptide=Lus10015173 locus=Lus10015173.g ID=Lus10015173.BGIv1.0 annot-version=v1.0 MQNEEGQNVDLYIPRKCSATNRLITSKDHASVQINVGHLDATGRYTGQFTTFALCGFVRAQGDGDSGLDRLWQKKKAELRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27700			Ribosomal protein S21e (.1)		Lus10015173 [exp]	0	1
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Lus10008873 [exp]	1.0	0.9752
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10014676 [exp]	1.7	0.9706
AT4G18100			Ribosomal protein L32e (.1)		Lus10009591 [exp]	2.8	0.9734
AT4G18100			Ribosomal protein L32e (.1)		Lus10020410 [exp]	4.5	0.9641
AT1G41880			Ribosomal protein L35Ae family...		Lus10028254 [exp]	4.9	0.9577
AT5G57290			60S acidic ribosomal protein f...		Lus10012714 [exp]	4.9	0.9540
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10022057 [exp]	5.0	0.9636
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	5.9	0.9569
AT1G13690		ATE1	ATPase E1 (.1)		Lus10004641 [exp]	6.9	0.9471
AT5G56710			Ribosomal protein L31e family ...		Lus10037703 [exp]	7.1	0.9467

Compare expression of checked genes

Lus10015173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.