Lus10015182 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05340 162 / 3e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G24000 129 / 2e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49170 128 / 9e-35 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G13650 127 / 2e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G22070 126 / 2e-34 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G13270 122 / 1e-32 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G08510 114 / 4e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49142 113 / 9e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G68930 113 / 1e-29 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G59200 112 / 2e-29 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031504 256 / 1e-82 AT3G05340 754 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018978 120 / 5e-32 AT4G13650 1258 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016425 119 / 8e-32 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10018223 118 / 2e-31 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015414 118 / 3e-31 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013991 117 / 3e-31 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10038741 117 / 3e-31 AT3G24000 739 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10039117 117 / 3e-31 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009269 115 / 2e-30 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G021100 180 / 5e-54 AT3G05340 860 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G066100 130 / 1e-35 AT5G13270 977 / 0.0 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G058900 126 / 4e-34 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G085500 124 / 1e-33 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.007G104700 119 / 1e-31 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G018700 119 / 1e-31 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G100600 117 / 6e-31 AT1G16480 397 / 1e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.012G018800 115 / 1e-30 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G175900 115 / 1e-30 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G027800 114 / 7e-30 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10015182 pacid=23149491 polypeptide=Lus10015182 locus=Lus10015182.g ID=Lus10015182.BGIv1.0 annot-version=v1.0
ATGCATAGTATAGCCCGAGTCGGTCTGCTCAAAGAGGCATTAGCATTCATCGAGGGGCTACCAGTGGAGCCTGATGTGCTGATATGGCAGGCTTTGCTAG
GCGGATGCGTGATCCGTGTTAACGTAGAGATAGGAGAGCTGGCTGCTGAGGAGTTGTTCAAATGTTCACCTAATGAGCCGGCACCTTACGTTTTGCTGGC
GAATATTTACTCTTCTAACGATAAGTGGAAGGAGAGGGCTGTGGCTATCAGGAGGATGAAGGAAATTAGGGTTTCGAAAGAGACCGGGATTAGTTGGATC
GAGATTGAGAAGAGGGTTCATAGCTTTGTCGTTGAGGATAGAATGCATCCTCAAAGTGAGGAGATTTATAGGAGTTTGATGGAGTTGCTTGGGAATATGT
TGATGAAGGTTATGTTCCTGACAAGAGGTTTGTTCTTCATTATGATGTTCCTAATGGAAAAGGTGATGTGA
AA sequence
>Lus10015182 pacid=23149491 polypeptide=Lus10015182 locus=Lus10015182.g ID=Lus10015182.BGIv1.0 annot-version=v1.0
MHSIARVGLLKEALAFIEGLPVEPDVLIWQALLGGCVIRVNVEIGELAAEELFKCSPNEPAPYVLLANIYSSNDKWKERAVAIRRMKEIRVSKETGISWI
EIEKRVHSFVVEDRMHPQSEEIYRSLMELLGNMLMKVMFLTRGLFFIMMFLMEKVM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05340 Tetratricopeptide repeat (TPR)... Lus10015182 0 1
AT5G13230 Tetratricopeptide repeat (TPR)... Lus10014956 14.7 0.6406
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10027365 15.9 0.6781
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10003857 27.3 0.6320
AT5G01880 RING/U-box superfamily protein... Lus10025145 28.7 0.5764
AT1G22610 C2 calcium/lipid-binding plant... Lus10010269 30.4 0.5978
AT5G47460 Pentatricopeptide repeat (PPR)... Lus10007476 35.0 0.6216
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004518 37.6 0.5982
AT3G49680 ATBCAT-3 ,BCAT3 branched-chain aminotransferas... Lus10011604 48.2 0.5968
AT5G51920 Pyridoxal phosphate (PLP)-depe... Lus10002958 52.5 0.5202
AT3G15395 unknown protein Lus10027849 52.9 0.6062

Lus10015182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.