Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05340 130 / 7e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G31430 89 / 3e-21 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G69350 87 / 1e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G32430 85 / 1e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G24000 84 / 2e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G18750 83 / 5e-19 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G15130 82 / 6e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G21090 82 / 1e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G21065 82 / 1e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G50270 81 / 3e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031504 [exp] 273 / 4e-89 AT3G05340 754 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015225 [exp] 96 / 2e-23 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026460 [exp] 93 / 2e-22 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025009 [exp] 87 / 3e-20 AT1G15510 1020 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007806 [exp] 84 / 3e-19 AT3G03580 967 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018978 [exp] 83 / 6e-19 AT4G13650 1258 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009070 [exp] 83 / 7e-19 AT2G37320 515 / 2e-180 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025277 [exp] 82 / 8e-19 AT2G37320 509 / 3e-178 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021355 [exp] 82 / 8e-19 AT4G32430 835 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G021100 [exp] 158 / 1e-45 AT3G05340 860 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G006800 [exp] 87 / 2e-20 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.005G137900 [exp] 87 / 2e-20 AT3G09040 421 / 3e-131 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G135600 [exp] 86 / 4e-20 AT4G38010 672 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G186500 [exp] 85 / 9e-20 AT3G23330 717 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G096400 [exp] 85 / 1e-19 AT5G03800 993 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G075300 [exp] 85 / 1e-19 AT3G26540 815 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G137200 [exp] 83 / 5e-19 AT3G14330 787 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G068600 [exp] 83 / 5e-19 AT1G16480 1183 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.011G052300 [exp] 82 / 1e-18 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10015183 pacid=23149598 polypeptide=Lus10015183 locus=Lus10015183.g ID=Lus10015183.BGIv1.0 annot-version=v1.0 ATGATCAAAACCCAAGATCTATCCATCCAGTCTCTTGTCATTAATAACTCCCTCCTCTCGATGTACTGTAAGTGCAGAGTTTTGAGCAATGCTGGTAAGG TGTTCGACCAAATGCCGCTGAGAGATACCATATCATGGAACACACTGATTTCCGGGTTGTTAACAGCTGGTGAGTTTGAGGCTGGATTGGGGTGGTTTAA AAAGATGTTGAATTCTGGTGTATACAAGTTTGAACAAGCGACGTTGACCACAATTTTATCAGCCTGTGATGGAGATGACGACAAGCTTGGTTGTTACGTC AATAGGATGGTTCATGGTTTGGAATTCTTGAGTGGGTTCGATAAGGATATTAGCGTTGGGAATGTTTTGATAACTTCTTACTTAAAATGCGGGAGCTTTT ATTCAGGGAAACTGGTTTTTGACGAATGGTTGAAAGGAATGTCATCAGCTGGACTGCTGCAGTATCAGGGCTAG
AA sequence Show only first row Show all	>Lus10015183 pacid=23149598 polypeptide=Lus10015183 locus=Lus10015183.g ID=Lus10015183.BGIv1.0 annot-version=v1.0 MIKTQDLSIQSLVINNSLLSMYCKCRVLSNAGKVFDQMPLRDTISWNTLISGLLTAGEFEAGLGWFKKMLNSGVYKFEQATLTTILSACDGDDDKLGCYV NRMVHGLEFLSGFDKDISVGNVLITSYLKCGSFYSGKLVFDEWLKGMSSAGLLQYQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05340			Tetratricopeptide repeat (TPR)...		Lus10015183 [exp]	0	1
AT3G55610		P5CS2	delta 1-pyrroline-5-carboxylat...		Lus10040262 [exp]	6.0	0.8119
AT4G02990		RUG2, BSM	RUGOSA 2, BELAYA SMERT, Mitoch...		Lus10022321 [exp]	8.8	0.8355
AT5G01590			unknown protein		Lus10012500 [exp]	12.6	0.8423
AT1G12770		ISE1, EMB1586	INCREASED SIZE EXCLUSION LIMIT...		Lus10038140 [exp]	15.9	0.8394
AT4G18750		DOT4	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10015225 [exp]	16.7	0.8200
AT4G35130			Tetratricopeptide repeat (TPR)...		Lus10003233 [exp]	17.7	0.8040
AT3G55610		P5CS2	delta 1-pyrroline-5-carboxylat...		Lus10004696 [exp]	26.5	0.7895
AT3G54090		FLN1	fructokinase-like 1 (.1)		Lus10021118 [exp]	26.6	0.8215
AT5G63290			Radical SAM superfamily protei...		Lus10001104 [exp]	35.9	0.8080
AT1G06190			Rho termination factor (.1.2)		Lus10022920 [exp]	37.8	0.8136

Compare expression of checked genes

Lus10015183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.