Lus10015190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15570 79 / 6e-17 Phototropic-responsive NPH3 family protein (.1)
AT1G52770 78 / 1e-16 Phototropic-responsive NPH3 family protein (.1)
AT5G67440 72 / 1e-14 MEL2, NPY3 NAKED PINS IN YUC MUTANTS 3, MAB4/ENP/NPY1-LIKE 2, Phototropic-responsive NPH3 family protein (.1.2)
AT3G08660 65 / 3e-12 Phototropic-responsive NPH3 family protein (.1)
AT3G26490 64 / 7e-12 Phototropic-responsive NPH3 family protein (.1)
AT3G08570 63 / 2e-11 Phototropic-responsive NPH3 family protein (.1)
AT2G14820 61 / 7e-11 MEL3, NPY2 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1)
AT5G48800 56 / 3e-09 Phototropic-responsive NPH3 family protein (.1)
AT2G47860 54 / 1e-08 SETH6 Phototropic-responsive NPH3 family protein (.1.2.3)
AT5G03250 53 / 4e-08 Phototropic-responsive NPH3 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015169 326 / 2e-108 AT5G64330 264 / 7e-79 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Lus10026046 82 / 5e-18 AT5G10250 639 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Lus10014337 81 / 8e-18 AT5G10250 620 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Lus10023274 68 / 4e-13 AT1G30440 910 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10038531 63 / 2e-11 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10013799 61 / 1e-10 AT5G03250 672 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10037848 60 / 1e-10 AT3G15570 343 / 1e-115 Phototropic-responsive NPH3 family protein (.1)
Lus10011082 58 / 8e-10 AT5G67385 476 / 2e-162 Phototropic-responsive NPH3 family protein (.1)
Lus10025928 55 / 1e-08 AT5G48800 925 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G024400 138 / 4e-38 AT5G10250 331 / 5e-106 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Potri.005G075400 83 / 2e-18 AT5G10250 695 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Potri.001G175400 81 / 1e-17 AT1G52770 507 / 8e-179 Phototropic-responsive NPH3 family protein (.1)
Potri.003G058800 80 / 1e-17 AT3G15570 499 / 1e-175 Phototropic-responsive NPH3 family protein (.1)
Potri.007G093000 80 / 3e-17 AT5G10250 706 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Potri.017G048200 76 / 4e-16 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.013G073700 76 / 6e-16 AT5G17580 409 / 4e-137 Phototropic-responsive NPH3 family protein (.1)
Potri.007G112600 72 / 9e-15 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.010G223600 67 / 4e-13 AT5G03250 683 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.008G038600 64 / 6e-12 AT5G03250 723 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03000 NPH3 NPH3 family
Representative CDS sequence
>Lus10015190 pacid=23149513 polypeptide=Lus10015190 locus=Lus10015190.g ID=Lus10015190.BGIv1.0 annot-version=v1.0
ATGGTGCATCAGGACTGCGAAAGGGGAGACTTGACTTCGAATCGATGGCTCGAAGAGGTTGCTTCTCTGCGAATCGATCATTTCGTTCGAGTTGTTGAGT
CAATGAAGTGGGAAGGAATGAAGCCAGAGATTGTAAGCTCATTTTTGGAACATTGGCTCTTGAAAGGGTCTCACCGGCTAGAAAATCTAACAATTGAGAC
ACTGAAAGTTGCCATAGAAGGACTGATAAGGCTGCTTCCTGAGCAAGAAACCTCTATACCTTGCAACATTCTGCTTTATCTTCTCAAGCTTGGAACTTCC
ATACGAGCCGACCCAGAGCTATTAGCGAGGAGTGAGGCGAGAGCGGTTCGTAAGCTAGATGGTTGTAGAATTTCGGACCTCCTGGTTCGAAATTCTACGG
GAGTCGGTGCTCTGTATGATGTGGAAATTGTTGCCAGAGTTGTGAAAGCATATGTTGCTTGTGTTGCAAGTAACCCAACATCGGGGTTGCCTAATGTTGG
AAGATTGGTTGATAAGTATTTGTGTTCGCGTACTTCTGCTTGGCGTACTCCTCCGCTGAAACAGCGGCAGCGAAGCGATTCCTCATTATCCTTTTTCTTA
TTCTTGACAATTGACTAA
AA sequence
>Lus10015190 pacid=23149513 polypeptide=Lus10015190 locus=Lus10015190.g ID=Lus10015190.BGIv1.0 annot-version=v1.0
MVHQDCERGDLTSNRWLEEVASLRIDHFVRVVESMKWEGMKPEIVSSFLEHWLLKGSHRLENLTIETLKVAIEGLIRLLPEQETSIPCNILLYLLKLGTS
IRADPELLARSEARAVRKLDGCRISDLLVRNSTGVGALYDVEIVARVVKAYVACVASNPTSGLPNVGRLVDKYLCSRTSAWRTPPLKQRQRSDSSLSFFL
FLTID

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64330 JK218, RPT3, NP... ROOT PHOTOTROPISM 3, NON-PHOTO... Lus10015190 0 1
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10028514 4.2 0.9307
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10033427 5.0 0.9546
AT2G19860 ATHXK2 ARABIDOPSIS THALIANA HEXOKINAS... Lus10034980 6.0 0.9067
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10035525 7.1 0.9516
Lus10003755 9.5 0.9434
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10027771 11.0 0.9407
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10036832 13.0 0.9406
AT1G76750 Protein of unknown function (D... Lus10025591 16.2 0.6374
Lus10038295 16.5 0.9285
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10019195 17.9 0.9227

Lus10015190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.