Plant FIBer expression Database

Lus10015191 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05550 87 / 4e-24 Hypoxia-responsive family protein (.1)
AT5G27760 83 / 1e-22 Hypoxia-responsive family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020658
[exp]
113 / 2e-34 AT3G05550 94 / 6e-27 Hypoxia-responsive family protein (.1)
Lus10031490
[exp]
109 / 2e-33 AT3G05550 54 / 2e-11 Hypoxia-responsive family protein (.1)
Lus10029883
[exp]
106 / 4e-30 AT3G05550 93 / 2e-24 Hypoxia-responsive family protein (.1)
Lus10033002
[exp]
64 / 3e-15 AT3G05550 50 / 2e-09 Hypoxia-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G024500
[exp]
86 / 1e-23 AT5G27760 102 / 4e-30 Hypoxia-responsive family protein (.1)
Potri.013G015400
[exp]
83 / 1e-22 AT3G05550 102 / 5e-30 Hypoxia-responsive family protein (.1)
Potri.019G056000
[exp]
77 / 2e-20 AT3G05550 58 / 1e-12 Hypoxia-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04588 HIG_1_N Hypoxia induced protein conserved region
Representative CDS sequence
>Lus10015191 pacid=23149608 polypeptide=Lus10015191 locus=Lus10015191.g ID=Lus10015191.BGIv1.0 annot-version=v1.0
ATGGCTGGCGATTCAATCAGGGAATGGGTCTCCGAGCACAAGATGAGAACCGTCGCTTGCTTATGGGCTAGCGGGATTGCTGGCTCAATAGCCTACAACT
GGTCTCAACCAAACATGAAAACCAGCGTCAAGATCATCCATGCCAGGATGCACGCACAGGCGTTTACATTGGCTGCTCTGGTCGGAGGTGCTGCTGTTGA
ATGGTATGAACGTAGCCTCGACGAAAAAGCTAAGTGA
AA sequence
>Lus10015191 pacid=23149608 polypeptide=Lus10015191 locus=Lus10015191.g ID=Lus10015191.BGIv1.0 annot-version=v1.0
MAGDSIREWVSEHKMRTVACLWASGIAGSIAYNWSQPNMKTSVKIIHARMHAQAFTLAALVGGAAVEWYERSLDEKAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05550 Hypoxia-responsive family prot... Lus10015191
[exp]
0 1
AT5G53480 ARM repeat superfamily protein... Lus10031905
[exp]
1.0 0.7617
AT5G25530 DNAJ heat shock family protein... Lus10041254
[exp]
6.3 0.6543
AT1G33590 Leucine-rich repeat (LRR) fami... Lus10006160
[exp]
8.6 0.6873
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10018433
[exp]
9.5 0.6693
AT3G26040 HXXXD-type acyl-transferase fa... Lus10036868
[exp]
15.7 0.6440
Lus10006063
[exp]
16.1 0.6362
AT1G31550 GDSL-like Lipase/Acylhydrolase... Lus10026550
[exp]
19.4 0.6312
Lus10022511
[exp]
20.6 0.6296
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10024231
[exp]
21.7 0.6296
Lus10010827
[exp]
22.7 0.6296

Lus10015191 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.