Lus10015193 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56220 105 / 5e-30 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G54070 48 / 7e-08 Dormancy/auxin associated family protein (.1)
AT1G28330 46 / 4e-07 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
AT5G44300 37 / 0.001 Dormancy/auxin associated family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031488 144 / 5e-45 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10020661 106 / 3e-30 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10029881 103 / 5e-27 AT5G27830 245 / 9e-80 unknown protein
Lus10025446 49 / 2e-08 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
Lus10013180 49 / 1e-07 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1)
Lus10008142 47 / 2e-07 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Lus10015318 44 / 3e-06 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013997 42 / 1e-05 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015418 42 / 1e-05 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G014900 97 / 2e-26 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.005G024250 90 / 3e-24 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.003G070500 59 / 7e-12 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
Potri.001G164800 52 / 4e-09 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
Potri.004G047100 47 / 5e-07 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Lus10015193 pacid=23149555 polypeptide=Lus10015193 locus=Lus10015193.g ID=Lus10015193.BGIv1.0 annot-version=v1.0
ATGAGTCTTCTTGACCAGCTGTGGGACGACACCGTCGCCGGTCCAAGGCCGGACAGCGGCCTCGGCAAGCTCCGCAAGCACAGAACCTTCGGTTTCCGAT
CGGCCACCGGCAACGATTCCGATGGAGGCGGGAGCGTGAAATCGTACTCCGGCGGTGATGAAGCAGCAGCAGCAGCGCCAGAGGAATCTACGAGAGTGAC
ACGCAGTATCATGATAGTGAGGCCGCCGGGTTACCAGAGCGGATCTACTCCCCCGGCGTCTCCTGCCGGATCTACTCCTCCCGTGTCTCCATTTTCCGGA
AGCAGCAGAGGCTCATTCAGGTTCCGGAGAAGGTCAGCATCGGATGCAGCATTCGAGAAGGAGGCGGCTGCTGCCACCGCTGCAGGAAGCCCAGTTGGAC
CAAGGAGCTCTTCTTCTCCTTACGACGTTTGA
AA sequence
>Lus10015193 pacid=23149555 polypeptide=Lus10015193 locus=Lus10015193.g ID=Lus10015193.BGIv1.0 annot-version=v1.0
MSLLDQLWDDTVAGPRPDSGLGKLRKHRTFGFRSATGNDSDGGGSVKSYSGGDEAAAAAPEESTRVTRSIMIVRPPGYQSGSTPPASPAGSTPPVSPFSG
SSRGSFRFRRRSASDAAFEKEAAAATAAGSPVGPRSSSSPYDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56220 Dormancy/auxin associated fami... Lus10015193 0 1
AT3G13340 Transducin/WD40 repeat-like su... Lus10041268 2.8 0.8086
AT1G16250 Galactose oxidase/kelch repeat... Lus10013899 5.5 0.8020
AT2G46690 SAUR-like auxin-responsive pro... Lus10008845 7.2 0.8007
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10013243 8.5 0.7482
AT4G14540 CCAAT NF-YB3 "nuclear factor Y, subunit B3"... Lus10022514 9.8 0.8072
AT1G53210 sodium/calcium exchanger famil... Lus10028144 13.3 0.7554
AT3G21870 CYCP2;1 cyclin p2;1 (.1) Lus10027148 17.9 0.7910
AT5G28150 Plant protein of unknown funct... Lus10042600 18.2 0.7358
AT5G56190 Transducin/WD40 repeat-like su... Lus10021975 19.1 0.7400
AT1G20560 AAE1 acyl activating enzyme 1 (.1.2... Lus10016011 20.9 0.7630

Lus10015193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.