Lus10015194 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27820 120 / 1e-36 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031487 155 / 2e-50 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G100900 120 / 3e-36 AT5G27820 155 / 3e-50 Ribosomal L18p/L5e family protein (.1)
Potri.005G068300 58 / 2e-12 AT5G27820 68 / 2e-16 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Lus10015194 pacid=23149531 polypeptide=Lus10015194 locus=Lus10015194.g ID=Lus10015194.BGIv1.0 annot-version=v1.0
ATGGTGATTCCACCAGCAATGAGACCACCAAGGATCACAGAGTATCTGAAGCCCTATGTGCTGAAGATGCATTTCAGCAACAAGTATGTTTCAGCGACGG
TGGTCCACACACCAACTGCAACTGTCGCGTCCTCTGCAAGCTCGCAAGAGAAGACCCTGAGGACAGTCATGGGAAACACTCGTGATGTTGCAGCTGCTGC
CAAAATCGGTAAGCTTCTAGGAGAGCGCCTGCTGCTGAAAGGGATACCGGCTGTTTCGATTCTGCTGAAGAGGGAACAGAAGTATCACGGTAAGATCAAG
GCTATTGTTGATTCCGTTAGGGAATCTGGCGTTAAGCTTATCTAG
AA sequence
>Lus10015194 pacid=23149531 polypeptide=Lus10015194 locus=Lus10015194.g ID=Lus10015194.BGIv1.0 annot-version=v1.0
MVIPPAMRPPRITEYLKPYVLKMHFSNKYVSATVVHTPTATVASSASSQEKTLRTVMGNTRDVAAAAKIGKLLGERLLLKGIPAVSILLKREQKYHGKIK
AIVDSVRESGVKLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27820 Ribosomal L18p/L5e family prot... Lus10015194 0 1
AT4G39520 GTP-binding protein-related (.... Lus10005800 6.9 0.9318
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10010429 9.4 0.9344
AT4G31810 ATP-dependent caseinolytic (Cl... Lus10010685 12.6 0.9281
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Lus10032591 19.6 0.9249
AT3G27740 VEN6, CARA VENOSA 6, carbamoyl phosphate ... Lus10018639 22.4 0.9242
AT2G13290 beta-1,4-N-acetylglucosaminylt... Lus10019400 22.8 0.9273
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10013440 24.0 0.9169
AT5G44500 Small nuclear ribonucleoprotei... Lus10013108 25.5 0.9268
AT3G01280 VDAC1, ATVDAC1 ARABIDOPSIS THALIANA VOLTAGE D... Lus10013271 26.1 0.9159
AT4G32690 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemo... Lus10022120 27.1 0.9164

Lus10015194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.