Lus10015198 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05590 310 / 2e-109 RPL18 ribosomal protein L18 (.1)
AT5G27850 309 / 7e-109 Ribosomal protein L18e/L15 superfamily protein (.1)
AT2G47570 226 / 8e-77 Ribosomal protein L18e/L15 superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029879 339 / 1e-120 AT5G27850 330 / 3e-117 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10041264 337 / 5e-120 AT5G27850 330 / 4e-117 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10031485 342 / 4e-119 AT3G05590 333 / 9e-116 ribosomal protein L18 (.1)
Lus10020659 333 / 6e-114 AT3G05580 562 / 0.0 type one protein phosphatase 9, Calcineurin-like metallo-phosphoesterase superfamily protein (.1)
Lus10021971 331 / 8e-112 AT5G42390 629 / 0.0 stromal processing peptidase, Insulinase (Peptidase family M16) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G202800 328 / 2e-116 AT3G05590 340 / 3e-121 ribosomal protein L18 (.1)
Potri.014G127300 327 / 5e-116 AT3G05590 334 / 8e-119 ribosomal protein L18 (.1)
Potri.005G023500 322 / 3e-114 AT3G05590 320 / 2e-113 ribosomal protein L18 (.1)
Potri.013G013600 320 / 4e-113 AT3G05590 337 / 8e-120 ribosomal protein L18 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10015198 pacid=23149486 polypeptide=Lus10015198 locus=Lus10015198.g ID=Lus10015198.BGIv1.0 annot-version=v1.0
ATGGGTATCGATTTGAAGGCAGGAGGTAAGAGGAAGAAGACCAAGAGGACGGCTCCCAAGTCCAATGATATCTACCTCAAGCTCCTCGTCAAGCTGTACC
GATTTCTGGTGAGGAGGACTGGAAGCAGCTTCAACGGTGTGATTTTGAAGAGGCTGTTCATGAGCAAGATCAACAAGCCCCCGCTATCACTCTCCAGGCT
CATCCGATTTATGGAGGGAAAGGATGGAAAGATTGCTGTGATTGTTGGAACAATCACCGATGATATTAGAGTTTATGATGTTCCGGCTATGAAGGTGACT
GCTTTGAGGTTCACTGAGACTGCTAGAGCTAGAATTGAGAAGGCTGGTGGTGAGTGCTTGACATTTGACCAGCTCGCCTTGAGAGCACCTCTTGGCCAGA
ACACGGTTCTCCTCAGGGGTCCTAAGAACGCTCGTGAGGCAGTGAAGCACTTTGGCCCAGCTCCTGGTGTGCCACACAGCCACACCAAGCCTTATGTCAG
GTCGAAGGGAAGGAAGTTCGAAAAAGCTAGGGGAAGGAGGAACAGCAGAGGATTCAGGGTTTAA
AA sequence
>Lus10015198 pacid=23149486 polypeptide=Lus10015198 locus=Lus10015198.g ID=Lus10015198.BGIv1.0 annot-version=v1.0
MGIDLKAGGKRKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSSFNGVILKRLFMSKINKPPLSLSRLIRFMEGKDGKIAVIVGTITDDIRVYDVPAMKVT
ALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05590 RPL18 ribosomal protein L18 (.1) Lus10015198 0 1
AT2G47110 UBQ6 ubiquitin 6 (.1.2) Lus10030595 1.0 0.9803
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10010429 1.4 0.9800
AT5G35530 Ribosomal protein S3 family pr... Lus10030502 2.2 0.9776
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10000946 2.8 0.9780
AT1G74050 Ribosomal protein L6 family pr... Lus10039083 3.5 0.9787
AT1G09590 Translation protein SH3-like f... Lus10017232 4.1 0.9652
AT4G16720 Ribosomal protein L23/L15e fam... Lus10004743 4.6 0.9740
AT2G42740 RPL16A ribosomal protein large subuni... Lus10033607 4.9 0.9748
AT2G43770 Transducin/WD40 repeat-like su... Lus10002860 6.9 0.9664
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10005441 7.2 0.9670

Lus10015198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.